CAZyme Information: MGYG000002135_02258

Basic Information

• Species: Anaeromassilibacillus sp002159845
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Anaeromassilibacillus; Anaeromassilibacillus sp002159845
• CAZyme ID: MGYG000002135_02258
• CAZy Family: GH110
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1831		199740.25	3.8885

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002135	2740278	MAG	United States	North America

• Gene Location: Start: 16128; End: 21623 Strand: -

Full Sequence      

MKGNKWKGAVSWLCIIALVLTSCFATFALPTNAFASEEGTVIDVTDFGADPSGQEDSAVP
IQKAIEAAKEVDGPVTIYFPKGEYNIWPDDAITRRIYISNSTTPSSTELEENSIRTIGIL
LEDMQDVTLDGGGSKLLFHGKMMSFAVIDCENVKIQNLTYDFARPYVIDLTVEAVTEDTA
TVYIPDCYEYAIDGNRLIFYGEVSPKTGNRYWIYDDYPFDQWNNLLTGEIHRAWDGCMTL
FENCTSIEELGNRRVLFHYSAPPKAQAGYNIQIKETTRDNPSMLLWESEDVTIRDINANF
LHSFAIIGQFSKDITIDNVDVATNARKGTKTAASADVIQMSGCGGKITVQNCYFNNSQDD
PINIHGTFLEIQEILAPNKVRVRYMERETYGFPNYYVGDEVEFIARSSLQAVGSEEVRNA
IVTEVENPAEEDYDPENRKNIVLTFDRDLPDEILNSGDPTGYVVENITYTPDVEIRNNVF
SQSSCRGLLCTTRGDVLIEGNQFRNIDMWTIFISDDANGWYESGYTRNVTIRDNVFWEGN
QTNIHIEPIIQELDPNNPLHKNMTIEGNTFYLNNTSAISALSVENLTIRDNAFKRADDGI
DSELTVSTSELRAGEKAELKLDMSTNVNDAGLFSFRGCKNVVLSGNTYGDGLNTRASVSD
MDTSEIHLEDEDVRLNEDSIKQFLLKDCKVQYISTDESVVRVDGAGGTVEAVAPGHAQVY
ASMMATDGSVFESNRVDITVSDGQGAAAESVKISAPQDILRTAGETMQLSAETVPAEAGA
ELTWSVADAATGAATEAATIDADGVLTAVQDGVVEVRAASANGVSDSMLVSISIGGETVI
PEIEYEVPGFWAIDDPDVLTLTVPNLYGFFDIRDEQQNVVTFPIADGENFEATVRVTGKT
YQTYEEIGFGILKDLDNYVACQKKNHLGTILVTESNRVGNEDHRVGKDDQDGFYYDDAID
FKIVKSGDHFEGYYRRTTEGADWVKFAELDNTTVGNTGLKLALWTASGENSGNQITFSEL
TINGEPQAFAYENQAPAASDAAFDTAQAAVGDTLSVQYAFSDPDGDAEAGSVIAWYAADA
ADGEYTKISGASGDTWTIPAGYQGKYIKASVIPADASGMPGEAVYTGAMGPVDMRGDPMG
NAYLKTLTLQKASGAGIALSPNFSGENLDYQAYSSAAELRISAQPESEGAEVSFALNGQP
VDATSLTLQEGENELAVTVTAADSSSRTYTVTVTYEALPESPNAWLSNLELGEEELSSPF
SFTTYGYITGVTEEVESLPLRCATQNPDARMKVTVNDEVLAEDVASFDEEIQILSGLNYI
DMDVTAPDGKQQQYLLVVVRNGYTDTDLADLKVNGETIEGFDPEKTDYLITSEEPVSFTL
EAEAANSRSSVIVSNGHETTGGSALSCEAGPGLTRFTIAVKAESLAETKYYTIRVKVAQE
DNANLERASFSDISLEEEVQPDVLTYRGSSYRSSTQFVLEAEEMGATIAFTANGESFTSE
GNLLEGEIPLYLGENVLRATVTAPDGSEQEYVFRIDVTDTAYLSDLPWVRAESGWEGHPV
LRDQEIERRPLTLYNEEAGGPVTYEKGLGTHAESTIVYDIADQGFTRFQSWCGIDYSYYD
SSAPTVQFIVYLDGEPAFDSGVMNAKSPAQFIDLDLTGVETIQLDALMVDTNNSDHADWA
DAKFLTEVSASENRIYSDTYEIAGGQATIPEGTTVQEALEQFYAYEGELAIVDADGKEME
PDALLEDGCEVTLTVQGEVIDRVVIVVAASGVEGDVTGDGVFDDEDITYVMDFILGNVEL
TEEELSAVDLNHDGVCNVLDLVKLKRMLLEG

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH110	41	598	8.5e-162	0.9543795620437956
CBM51	1542	1684	1.1e-38	0.9850746268656716

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08305	NPCBM	3.03e-43	1539	1684	1	135	NPCBM/NEW2 domain. This novel putative carbohydrate binding module (NPCBM) domain is found at the N-terminus of glycosyl hydrolase family 98 proteins. This domain has also been called the NEW2 domain (Naumoff DG. Phylogenetic analysis of alpha-galactosidases of the GH27 family. Molecular Biology (Engl Transl). (2004)38:388-399.)
smart00776	NPCBM	3.04e-30	1537	1684	1	144	This novel putative carbohydrate binding module (NPCBM) domain is found at the N-terminus of glycosyl hydrolase family 98 proteins.
cd14256	Dockerin_I	9.15e-14	1774	1829	2	57	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
pfam12733	Cadherin-like	1.75e-08	1157	1234	4	87	Cadherin-like beta sandwich domain. This domain is found in several bacterial, metazoan and chlorophyte algal proteins. A profile-profile comparison recovered the cadherin domain and a comparison of the predicted structure of this domain with the crystal structure of the cadherin showed a congruent seven stranded secondary structure. The domain is widespread in bacteria and seen in the firmicutes, actinobacteria, certain proteobacteria, bacteroides and chlamydiae with an expansion in Clostridium. In contrast, it is limited in its distribution in eukaryotes suggesting that it was derived through lateral transfer from bacteria. In prokaryotes, this domain is widely fused to other domains such as FNIII (Fibronectin Type III), TIG, SLH (S-layer homology), discoidin, cell-wall-binding repeat domain and alpha-amylase-like glycohydrolases. These associations are suggestive of a carbohydrate-binding function for this cadherin-like domain. In animal proteins it is associated with an ATP-grasp domain.
pfam00404	Dockerin_1	2.33e-06	1774	1829	1	56	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYE35188.1	2.14e-160	4	1372	6	1397
QAS60591.1	7.70e-160	4	1372	6	1397
BBA55548.1	2.49e-145	31	725	13	707
ADP36352.1	2.62e-145	3	725	9	727
ADO53462.1	6.63e-145	3	725	9	726

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7JW4_A	5.48e-47	29	598	15	571	Crystalstructure of PdGH110B in complex with D-galactose [Pseudoalteromonas distincta],7JW4_B Crystal structure of PdGH110B in complex with D-galactose [Pseudoalteromonas distincta]
7JWF_A	2.39e-46	29	598	15	571	Crystalstructure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta],7JWF_B Crystal structure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta],7JWF_C Crystal structure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta],7JWF_D Crystal structure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta]
7JRM_A	3.18e-21	1520	1692	62	233	ChainA, F5/8 type C domain protein [Clostridium perfringens ATCC 13124]
7JRL_A	3.85e-21	1520	1692	84	255	ChainA, F5/8 type C domain protein [Clostridium perfringens ATCC 13124]
7JS4_A	1.38e-19	1424	1684	712	975	ChainA, F5/8 type C domain protein [Clostridium perfringens ATCC 13124]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B1V8K7	1.71e-128	40	741	33	724	Alpha-1,3-galactosidase A OS=Streptacidiphilus griseoplanus OX=66896 GN=glaA PE=1 SV=1
Q826C5	6.20e-119	30	654	29	620	Alpha-1,3-galactosidase A OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=glaA PE=3 SV=1
Q5L7M8	6.58e-90	19	597	7	554	Alpha-1,3-galactosidase A OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=glaA PE=3 SV=1
Q64MU6	1.21e-89	19	597	7	554	Alpha-1,3-galactosidase A OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=glaA PE=3 SV=1
Q8A2Z5	5.73e-77	61	597	31	536	Alpha-1,3-galactosidase A OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=glaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001307	0.602172	0.395567	0.000454	0.000266	0.000220

TMHMM  Annotations     

start	end
9	31