CAZyme Information: MGYG000002155_00724

Basic Information

• Species: Ruthenibacterium sp900546885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruthenibacterium; Ruthenibacterium sp900546885
• CAZyme ID: MGYG000002155_00724
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
599	MGYG000002155_6|CGC1	66510.51	7.8445

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002155	2379587	MAG	Germany	Europe

• Gene Location: Start: 5828; End: 7627 Strand: -

Full Sequence      

MRLRLKRMRELCAVFVSLVRQDGISSTVQRALGFARRRLKSKKGRFLPPKAVLESQRALD
YSTWPHVSICVPVYNTPRAYLEQMWNSVAGQTCPNWQLCVADASDAAHAYVGEFFAAKKN
VRYCKVANNGISANTNAAAQLAGGEYLALLDHDDVLAPHAVYEMLKAARQTGAAFLYSDE
ALFETSIERPSAGHFKPDFAPDYLNCCNYICHFAMFQAGLFHAVGGLDSACDGAQDHDLF
LKLSERCTPVHVPKVLYYWRVHAGSTSGGTAAKPYVTAAAKRAIAAHLARTGAEGTVQDG
LFPSTYKVDYTLAHTPLVSILIPNKDHTEDLDKALRSILEKTDYPAYEVIVIENNSTQPQ
TFAYYETIARDAAYSRCRVVQYQGPFNFSAINNFGRKAAKGEFLLLLNNDVEVISPAWLT
EMVKLCSQPGAGIVGAKLYYPDGTVQHAGVITGLGGYAGHSHKYTRRASGGYMFRLATVQ
NFSCVTAACLLCRASVYDEVGGLDEGFTVAFNDVDFCLRVRQAGWRVLWTPYAELYHYES
KSRGLDTKGPAKERFEGERRRLKQRWGEALLHDPFYNPNLTLDREDFSESDVLPKEEPA

Enzyme Prediction     

No EC number prediction in MGYG000002155_00724.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	68	175	8.3e-21	0.6529411764705882
GT2	318	547	2.1e-20	0.9260869565217391

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	1.04e-74	65	261	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	2.14e-44	320	539	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.03e-31	315	566	2	248	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	1.01e-19	68	221	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	1.68e-19	68	267	1	201	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL01588.1	3.24e-250	1	593	1	611
ATL90529.1	7.50e-250	1	593	1	611
AXB27819.1	9.24e-250	1	593	1	611
QIA43913.1	1.42e-247	1	593	1	611
ATP00360.1	1.42e-247	1	593	1	611

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Z86_A	1.33e-17	65	267	375	579	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]
2Z87_A	1.33e-17	65	267	374	578	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	7.28e-130	65	587	366	895	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	8.70e-89	49	586	302	837	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q9CMP0	3.44e-17	65	267	433	637	Chondroitin synthase OS=Pasteurella multocida (strain Pm70) OX=272843 GN=fcbD PE=3 SV=1
Q7BLV3	3.45e-17	65	267	440	644	Hyaluronan synthase OS=Pasteurella multocida OX=747 GN=hyaD PE=1 SV=2
Q8L0V4	8.09e-17	65	267	432	636	Chondroitin synthase OS=Escherichia coli OX=562 GN=kfoC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002155_00724.