CAZyme Information: MGYG000002158_01175

Basic Information

• Species: Desulfovibrio desulfuricans_A
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio; Desulfovibrio desulfuricans_A
• CAZyme ID: MGYG000002158_01175
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359	MGYG000002158_15|CGC1	39007.5	8.3949

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002158	2806718	MAG	Germany	Europe

• Gene Location: Start: 45242; End: 46321 Strand: +

Full Sequence      

MKRHKTLAILAGCLGSTLLLLGLLAGFVPQHEGYEVRRRASPVVVSLRPEDMPAPIVPQG
DGSRQWSLRRAASPVVAPVSLADASSRAETEDGDGFFSQVPAGTGQLASLLALDGFSMPP
LLAVQPSRFGDAVDARGLPLRWLAAETLLEGYSPLPPRTGKTAGQGGTRGMSAANAFYGN
DMLPPRARRYQQIVESFAGRYNLSTELVYAIIHSESSFSPTLVSHKSAMGLMQILPDTAG
GEVHRYLYGRTGDVSFEDLRVPETNIRYGTTYLHILLTRYFAGVHDPRAREYCAVAAYNM
GPNRFLRLFGNSPEEAVDAINALTAEQLYEDLTIRLPVAETRAYVAKVARMKGHYAALQ

Enzyme Prediction     

No EC number prediction in MGYG000002158_01175.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	192	350	1.9e-23	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16893	LT_MltC_MltE	1.62e-73	193	352	2	161	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK11671	mltC	2.48e-41	186	355	188	356	membrane-bound lytic murein transglycosylase MltC.
cd16896	LT_Slt70-like	1.65e-38	189	348	3	140	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK15470	emtA	8.05e-30	186	350	35	198	membrane-bound lytic murein transglycosylase EmtA.
cd13401	Slt70-like	6.07e-29	188	348	4	142	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATD80276.1	1.02e-259	1	359	1	359
SPD35752.1	1.02e-259	1	359	1	359
VZH33299.1	1.01e-178	1	359	1	357
AMD88640.1	2.21e-147	1	359	1	379
QCC84560.1	1.66e-130	1	359	1	392

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C5F_A	1.51e-33	122	355	109	338	Structureof Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli],4C5F_B Structure of Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli]
4CFO_A	4.05e-33	122	355	109	338	Structureof Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFO_B Structure of Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFP_A Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CFP_B Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CHX_A Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli],4CHX_B Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli]
5MPQ_A	7.25e-10	190	358	416	558	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	7.28e-10	190	358	420	562	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	7.32e-10	190	358	426	568	Lytictransglycosylase in action [Neisseria meningitidis MC58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7MLX9	4.42e-33	125	355	131	357	Membrane-bound lytic murein transglycosylase C OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=mltC PE=3 SV=2
Q8Z3T9	4.42e-33	122	355	128	357	Membrane-bound lytic murein transglycosylase C OS=Salmonella typhi OX=90370 GN=mltC PE=3 SV=2
Q0T0S4	6.02e-33	122	355	127	356	Membrane-bound lytic murein transglycosylase C OS=Shigella flexneri serotype 5b (strain 8401) OX=373384 GN=mltC PE=3 SV=2
Q83Q83	6.02e-33	122	355	127	356	Membrane-bound lytic murein transglycosylase C OS=Shigella flexneri OX=623 GN=mltC PE=3 SV=2
Q57K03	6.14e-33	122	355	128	357	Membrane-bound lytic murein transglycosylase C OS=Salmonella choleraesuis (strain SC-B67) OX=321314 GN=mltC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999653	0.000246	0.000058	0.000002	0.000001	0.000082

TMHMM  Annotations     

start	end
7	29