CAZyme Information: MGYG000002201_00590

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508
• CAZyme ID: MGYG000002201_00590
• CAZy Family: GH94
• CAZyme Description: Cyclic beta-(1,2)-glucan synthase NdvB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293		34056.18	4.8418

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002201	1369587	MAG	Spain	Europe

• Gene Location: Start: 43635; End: 44516 Strand: +

Full Sequence      

MQDTLGLKYINTDFMKQQILLASKHQFEEGDVLHWWHEDTQRGIRTRFSDDLLWLPYTVA
EYISFTGDWSLLEEETNYLKGEVLKEGEEERYDYYPESDHKESIWEHCKKAIEHSFSFGE
HGLPKIGTGDWNDGMSTVGNKGKGESVWLGFFLYDVLQKMIPIAKEKKEEKLAQKYEEVK
ENLKRALNTNAWDGRWYKRAYMDSGEALGSIENEECRIDNISQTWSVISRAGDNDKKYIS
MESLENHLIDTEHGLIKLLDPPFEKGKLEPGYIKGYLPGVRENGGQYTHVCCC

Enzyme Prediction     

EC	2.4.1.-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3459	COG3459	1.76e-107	2	289	619	897	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
pfam17167	Glyco_hydro_36	4.13e-89	2	289	58	342	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADH61505.1	1.25e-118	1	290	2439	2728
ADD03073.1	3.17e-118	1	290	2439	2728
AIS53008.1	1.30e-116	1	290	2439	2728
AEV69563.1	8.29e-116	1	292	2472	2763
ADV79124.1	1.13e-115	1	290	2439	2728

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QDE_A	3.04e-32	2	289	364	653	ChainA, Cellobiose phosphorylase [Acetivibrio thermocellus],3QDE_B Chain B, Cellobiose phosphorylase [Acetivibrio thermocellus]
4ZLE_A	2.55e-31	2	290	353	627	Cellobionicacid phosphorylase - ligand free structure [Saccharophagus degradans 2-40],4ZLF_A Cellobionic acid phosphorylase - cellobionic acid complex [Saccharophagus degradans 2-40],4ZLG_A Cellobionic acid phosphorylase - gluconic acid complex [Saccharophagus degradans 2-40],4ZLI_A Cellobionic acid phosphorylase - 3-O-beta-D-glucopyranosyl-alpha-D-glucopyranuronic acid complex [Saccharophagus degradans 2-40]
3S4C_A	9.60e-28	2	290	371	667	Lactosephosphorylase in complex with sulfate [Cellulomonas uda],3S4D_A Lactose phosphorylase in a ternary complex with cellobiose and sulfate [Cellulomonas uda]
3RRS_A	3.23e-27	2	289	371	666	Crystalstructure analysis of cellobiose phosphorylase from Cellulomonas uda [Cellulomonas uda],3RRS_B Crystal structure analysis of cellobiose phosphorylase from Cellulomonas uda [Cellulomonas uda],3RSY_A Cellobiose phosphorylase from Cellulomonas uda in complex with sulfate and glycerol [Cellulomonas uda],3RSY_B Cellobiose phosphorylase from Cellulomonas uda in complex with sulfate and glycerol [Cellulomonas uda],3S4A_A Cellobiose phosphorylase from Cellulomonas uda in complex with cellobiose [Cellulomonas uda],3S4A_B Cellobiose phosphorylase from Cellulomonas uda in complex with cellobiose [Cellulomonas uda],3S4B_A Cellobiose phosphorylase from Cellulomonas uda in complex with glucose [Cellulomonas uda],3S4B_B Cellobiose phosphorylase from Cellulomonas uda in complex with glucose [Cellulomonas uda]
2CQS_A	3.26e-27	2	289	391	686	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQS_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQT_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],2CQT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],3QFY_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFY_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFZ_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QFZ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20471	4.65e-77	1	290	2397	2687	Cyclic beta-(1,2)-glucan synthase NdvB OS=Rhizobium meliloti (strain 1021) OX=266834 GN=ndvB PE=1 SV=2
B9K7M6	1.91e-30	2	289	365	655	Cellobiose phosphorylase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=cbpA PE=1 SV=1
Q7S0S2	3.35e-28	1	290	359	633	Cellobionic acid phosphorylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU09425 PE=1 SV=1
Q76IQ9	3.22e-26	2	289	353	644	N,N'-diacetylchitobiose phosphorylase OS=Vibrio proteolyticus OX=671 GN=chbP PE=1 SV=1
Q9F8X1	1.14e-22	38	289	414	644	N,N'-diacetylchitobiose phosphorylase OS=Vibrio furnissii OX=29494 GN=chbP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002201_00590.