CAZyme Information: MGYG000002283_04343

Basic Information

• Species: Bacillus_A paranthracis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae_G; Bacillus_A; Bacillus_A paranthracis
• CAZyme ID: MGYG000002283_04343
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
534		59904.17	7.1275

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002283	5102264	Isolate	China	Asia

• Gene Location: Start: 178213; End: 179817 Strand: +

Full Sequence      

MYVFLSFLMFAWKGKRGTSMRVSVIIPAHNEASTLSQVLVEVEKLKPYEIIVVDNGSTDG
TKEIALQHHCHVIYYKYSLGNDVGRAIGAREAKGDSVLFLDGDIVIDHRELQRFIKGIQQ
GHQIVVNNLTWSVYLKMRPHYTTVGKFMLNRYLNKKELVVGSLIAIPHAMSREVIQKFGW
WNLADPALFQAMAMSRGVDIVDMASVDVIHTNKVRPVHTGTSPGSPYPKATSRIMGDHLR
ALQYVIEIYGKRGGFSEGKRDREFIGKYKPILLQREKAKYSAIIPVSEEKTTIRSVIQEV
KKAGIDEIIVVANGADVETVKQAKLENVIVIEFEEALGHNVARAIGAMHATADICLFVDG
DFVIPGEKLIPFLHAIEDGNDVALNDLQCLLDMFHPADPISMGKYFVNLVAKRPDLWNNS
LTAVPHAMHKKVIEKIGYDSLIIPPLAQMKAILEGFSITAVDFVDVIKTNRVRPEQHGFV
NGRIPAFDRIFGDQLEAIAYLLQSTDERGSFTDGERNRNIIQQLRKEEENTDEC

Enzyme Prediction     

No EC number prediction in MGYG000002283_04343.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	23	128	1e-22	0.6705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR04283	glyco_like_mftF	1.72e-18	22	124	1	102	transferase 2, rSAM/selenodomain-associated. This enzyme may transfer a nucleotide, or it sugar moiety, as part of a biosynthetic pathway. Other proposed members of the pathway include another transferase (TIGR04282), a phosphoesterase, and a radical SAM enzyme (TIGR04167) whose C-terminal domain (pfam12345) frequently contains a selenocysteine. [Unknown function, Enzymes of unknown specificity]
pfam00535	Glycos_transf_2	2.52e-18	23	175	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	2.80e-18	24	126	1	110	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd04179	DPM_DPG-synthase_like	3.41e-17	24	126	1	113	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
cd02522	GT_2_like_a	4.91e-17	22	103	1	82	GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function. Glycosyltransferase family 2 (GT-2) subfamily of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAL16275.1	0.0	1	534	1	534
QPI84171.1	0.0	9	534	1	526
AYY30323.1	0.0	9	534	1	526
QHA29819.1	0.0	9	534	1	526
QRH09005.1	0.0	9	534	1	526

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MLZ_A	1.04e-07	19	176	22	190	Dolichylphosphate mannose synthase in complex with GDP and Mg2+ [Pyrococcus furiosus DSM 3638],5MM0_A Dolichyl phosphate mannose synthase in complex with GDP-mannose and Mn2+ (donor complex) [Pyrococcus furiosus DSM 3638],5MM1_A Dolichyl phosphate mannose synthase in complex with GDP and dolichyl phosphate mannose [Pyrococcus furiosus DSM 3638]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D4GYG7	9.58e-09	22	132	8	128	Glycosyltransferase AglE OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglE PE=1 SV=1
D4GYG3	4.06e-08	22	155	7	136	Glycosyltransferase AglJ OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglJ PE=1 SV=1
Q7N3Q6	4.67e-08	21	125	8	123	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=arnC PE=2 SV=1
A4SQW8	1.48e-07	22	125	9	123	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnC PE=3 SV=1
Q6D2F0	3.53e-07	22	125	8	122	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=arnC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.962939	0.035537	0.001205	0.000106	0.000054	0.000174

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002283_04343.