CAZyme Information: MGYG000002293_00436

Basic Information

• Species: Prevotella sp900557255
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900557255
• CAZyme ID: MGYG000002293_00436
• CAZy Family: CE6
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
636	MGYG000002293_3|CGC2	71571.91	7.9712

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002293	3611909	Isolate	China	Asia

• Gene Location: Start: 70494; End: 72404 Strand: +

Full Sequence      

MNRLSILASMLAMACLPMMAQKTGSKVQEKPDPNFQIYLCFGQSNMEGNAAIEDIDRTGV
NPRFQAMYAVDDEKAGWKKGQWHTAVPPQARPSTGLTPVDYFGRKMVDNLPDSIKVGTIT
VAVGGASIDLFDKRTYKAYLKKQPDWMKNFASQYNGNPYARLIELAKIAKKQGVIKGILL
HQGETNNGDANWPNRVKTVYNDILKDLNLKAEDVPLLVGETVQKDMGGKCWAHIAIVDDI
AKTIPTAHVISSKGCPQRGDGLHFIAESYRTMGKRYANMMLALQGIIPDSNYPRVDKDRR
AYVKLHAPEAKKVIFDICGKQYEMKKDLDGDWYGVSDPLVVGFHYYFLNVDGVQVVDPAS
ETYFGCCREAGGLEVPEGAEGNYYRPQQGVAHGQVRSVSYYAASQKQFRRAMVYTPAEYE
TNTTKRYPVLYLQHGMGEDETGWSKQGMMQHIMDNLIAEGKAEPMIVVMESGDVKKPFVA
RPGKNVDEERSHYGASFYDVIIKDLIPMVDKTFRTYTDREHRAMAGLSWGGCQTFNTVLP
HMDKFSALGTFSGALFGVDVKTCFNGVFADAEKYNKNIHYMFMGCGSEENFGTEKMAQQL
KELGIKLDVYVSPGTHHEWLTWRRCFKEFIPHLFKW

Enzyme Prediction     

EC	3.1.1.72

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	406	632	1.7e-56	0.9559471365638766
CE6	98	208	1.6e-31	0.9797979797979798

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02858	E_set_Esterase_N	5.52e-40	299	376	1	78	N-terminal Early set domain associated with the catalytic domain of esterase. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
pfam03629	SASA	4.85e-34	34	282	1	226	Carbohydrate esterase, sialic acid-specific acetylesterase. The catalytic triad of this esterase enzyme comprises residues Ser127, His403 and Asp391 in UniProtKB:P70665.
COG2382	Fes	2.17e-26	368	635	36	297	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	5.09e-14	409	623	8	236	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2819	YbbA	2.06e-11	387	555	3	172	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT67597.1	0.0	1	636	1	636
QDH54067.1	3.17e-292	32	635	21	637
QDM11109.1	1.82e-291	32	635	21	637
ALJ48336.1	1.05e-290	32	635	21	637
QRQ55180.1	1.05e-290	32	635	21	637

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MOT_A	2.30e-103	287	635	13	359	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6MOU_A	4.67e-103	287	635	34	380	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393],6MOU_B Chain B, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
7B5V_A	4.59e-101	287	635	34	386	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6RZO_A	8.53e-83	288	635	12	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_B	8.80e-83	288	635	12	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	3.18e-250	6	635	10	670	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
D5EY13	6.17e-64	288	635	390	726	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P31471	1.72e-32	277	635	24	389	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
P10478	2.92e-28	383	630	39	273	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P51584	1.62e-10	413	634	845	1075	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000684	0.629681	0.368720	0.000357	0.000293	0.000236

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002293_00436.