CAZyme Information: MGYG000002337_01829

Basic Information

• Species: Staphylococcus aureus
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus aureus
• CAZyme ID: MGYG000002337_01829
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1509		165492.86	10.2076

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002337	2749621	Isolate	not provided	not provided

• Gene Location: Start: 1974352; End: 1978881 Strand: -

Full Sequence      

MGERIKGLSIGLDLDAANLNRSFAEIKRNFKTLNSDLKLTGNNFKYTEKSTHSYKQRIKE
LDGTITGYKKNVDDLAKQYGKVSQEQGENSAEAQKLRQEYNKQANELNFLEKELEKTTTE
FEEFKKAQVEAQRMAESGWGKTSKVFESMGPKLTKMGDGLKSIGKGLMIGVTAPVLGIAA
ASGKAFAEVDKGLDTVTQATGATGGELKKLQNSFKDVYGNFPADAETVGGVLGEVNTRLG
FTGKELESATESFLKFSHITGSDGVQAVQLITRAMGDAGIEADEYQSVLDMVAKAAQASG
ISVDTLADSITKYGAPMRAMGFEMKESIALFSQWEKSGVNTEIAFSGLKKAISNWGKAGK
DPREEFKKTLAEIERTPDIASATSLAIEAFGAKAGPDLADAIKGGRFSYQEFLKTIEDSQ
GTVNQTFKDSESGSERFKVAMNKLKLVGADVWASIESAFAPVMEELIKKLSVAVDWFSNL
SDGSKRSIVIFGGIAAAIGPVVFGLGAFISTIGNAVTVLAPLLAGIAKADGLISFLSTKV
PILGTVFTALTGPIGIVLGVLAGLAVAFTIAYKKSETFRNFVNGAIESVKQTFSNFIQFI
QPFIDSVKNIFKQAISAIVDFAKDIWSQINGFFNENGISIVQALQNICNFIKAIFEFIIN
FVIKPIMFAIWQVMQFIWPAVKALIVSTWENIKGVIQGALNIILGLIKFFSSLFTGDWRG
VWDAIVMILKGVVQLIWNLIQLWFVGKILGVVRYFGGLLKGLIAGIWDVIKSIFSKSLSA
IWNATKSIFGFLFNSVKSIFTNMKNWLSNTWSSIRTNTIGKAQSLFSGVKSKFTNLWNAT
KEIFSNLRNWMSNIWNSIKDNTVGIASRLWSKVRGIFTNMRDGLQSIISKIKSHIGGMVD
AIKKGLNKLIDGLNWVGGKLGMDKIPKLHTGTEHTHTTTRLVKNGKIARDTFATVGDKGR
GNGPNGFRNEMIEFPNGKRVITPNTDTTAYLPKGSKVYNGAQTYSMLNGTLPRFSLGTMW
KDIKSGASSAFNWTKDQIGKGTKWLGDKVGDVLDFIENPGKLLNYILEAFGIDFNSLTKG
MGIAGDITKAAWSKIKKSATDWIKENLEAMGGGDLVGGILDPDKINYHYGRTAAYTAATG
RPFHEGVDFPFVYQEVRTPMGGRLTRMPFMSGGYGNYVKITSGVIDMLFAHLKNFSKSPP
SGTMVKPGDVVGLTGNTGFSTGPHLHFEMRRNGRHFNPEPYLRNAKKKGRLSIGGGDATS
GSGATYASRVIRQAQSILGGRYKGKWIHDQMMRVAKRESNYQSNAVNNWDINAQRGDPSR
GLFQIIGSTFRANAKRGYTNYNNPVHQGISAMQYIVRRYGWGGFKRAGDYAYATGGKVFD
GWYNLGEDGHPEWIIPTDPARRNDAMKILHYAAAEVRGKKASKNKRPSQLSDLNGFDDPS
LLLKMIEQQQQQIALLLKIAQSNDVIADKDYQPIIDEYAFDKKVNASIEKRERQESTKVK
FRKGGIAIQ

Enzyme Prediction     

No EC number prediction in MGYG000002337_01829.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5412	COG5412	0.0	490	1142	1	637	Phage-related protein [Mobilome: prophages, transposons].
COG5280	YqbO	0.0	1	629	2	634	Phage-related minor tail protein [Mobilome: prophages, transposons].
COG3953	SLT	8.93e-71	1271	1504	1	235	SLT domain protein [Mobilome: prophages, transposons].
cd13402	LT_TF-like	3.63e-42	1289	1402	2	117	lytic transglycosylase-like domain of tail fiber-like proteins and similar domains. These tail fiber-like proteins are multi-domain proteins that include a lytic transglycosylase (LT) domain. Members of the LT family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, and the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL). LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01551	Peptidase_M23	1.08e-23	1143	1238	2	96	Peptidase family M23. Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXH28346.1	0.0	1	1509	1	1509
AWQ87447.1	0.0	1	1509	1	1509
AWE61763.1	0.0	1	1509	1	1509
APD04635.1	0.0	1	1509	1	1509
QEN61588.1	0.0	1	1509	1	1509

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RNY_A	1.13e-14	1144	1248	219	323	Structureof Helicobacter pylori Csd3 from the orthorhombic crystal [Helicobacter pylori 26695],4RNY_B Structure of Helicobacter pylori Csd3 from the orthorhombic crystal [Helicobacter pylori 26695],4RNZ_A Structure of Helicobacter pylori Csd3 from the hexagonal crystal [Helicobacter pylori 26695]
3SLU_A	1.10e-10	1144	1238	246	338	Crystalstructure of NMB0315 [Neisseria meningitidis ATCC 13091],3SLU_B Crystal structure of NMB0315 [Neisseria meningitidis ATCC 13091]
6MUK_A	1.29e-10	1144	1238	266	358	1.93Angstrom Resolution Crystal Structure of Peptidase M23 from Neisseria gonorrhoeae. [Neisseria gonorrhoeae FA 1090]
4QP5_A	3.27e-09	1120	1245	12	139	Catalyticdomain of the antimicrobial peptidase lysostaphin from Staphylococcus simulans crystallized in the presence of phosphate [Staphylococcus simulans bv. staphylolyticus],4QP5_B Catalytic domain of the antimicrobial peptidase lysostaphin from Staphylococcus simulans crystallized in the presence of phosphate [Staphylococcus simulans bv. staphylolyticus],4QPB_A Catalytic domain of the antimicrobial peptidase lysostaphin from Staphylococcus simulans crystallized in the absence of phosphate [Staphylococcus simulans],4QPB_B Catalytic domain of the antimicrobial peptidase lysostaphin from Staphylococcus simulans crystallized in the absence of phosphate [Staphylococcus simulans]
5J1L_A	1.89e-08	1171	1243	94	165	Crystalstructure of Csd1-Csd2 dimer I [Helicobacter pylori 26695],5J1L_C Crystal structure of Csd1-Csd2 dimer I [Helicobacter pylori 26695],5J1M_A Crystal structure of Csd1-Csd2 dimer II [Helicobacter pylori 26695],5J1M_C Crystal structure of Csd1-Csd2 dimer II [Helicobacter pylori 26695]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E7DNB6	8.24e-25	127	643	24	523	Tape measure protein OS=Pneumococcus phage Dp-1 OX=59241 GN=TMP PE=4 SV=1
P54334	4.62e-14	1258	1434	1083	1263	Phage-like element PBSX protein XkdO OS=Bacillus subtilis (strain 168) OX=224308 GN=xkdO PE=4 SV=2
P45931	1.64e-12	1258	1398	1335	1483	Uncharacterized protein YqbO OS=Bacillus subtilis (strain 168) OX=224308 GN=yqbO PE=1 SV=2
P44693	1.77e-10	1144	1238	348	442	Uncharacterized metalloprotease HI_0409 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0409 PE=3 SV=1
O05156	1.25e-07	1120	1245	129	256	Glycyl-glycine endopeptidase ALE-1 OS=Staphylococcus capitis OX=29388 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
487	509
516	538
548	570
657	679
694	716
735	757