CAZyme Information: MGYG000002345_01503

Basic Information

• Species: Acinetobacter nosocomialis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter nosocomialis
• CAZyme ID: MGYG000002345_01503
• CAZy Family: CBM50
• CAZyme Description: putative protein YgaU

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
157		16852.12	4.7657

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002345	4020363	Isolate	United States	North America

• Gene Location: Start: 42690; End: 43163 Strand: -

Full Sequence      

MGLFDFVKGIGKKNTAPAEPQPAPATPAEPSAQEVANKLLGLIKSLGLGVEGLSVTYNGS
TDTATINGQVQSQADKEKIILIVGNVDHVAHVDDQMTVATPEPESKFYTVKSGDNLSKIA
KEFYGDANQYPKIFEANKPMLKDPDEIFPGQVLRIPQ

Enzyme Prediction     

No EC number prediction in MGYG000002345_01503.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11198	PRK11198	8.52e-75	1	157	1	147	LysM domain/BON superfamily protein; Provisional
COG1652	XkdP	1.80e-16	105	157	210	263	Nucleoid-associated protein YgaU, contains BON and LysM domains [Function unknown].
cd00118	LysM	4.79e-12	106	155	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	8.05e-10	107	155	1	44	Lysin motif.
NF033163	lipo_LipL71	9.22e-09	106	156	405	460	lipoprotein LipL71. Members of this family are lipoprotein LipL71, also known as LruA, as described in Leptospira interrogans but found broadly in the genus Leptospira. Close homologs that are not lipoproteins by sequence are likely defective in their reported coding region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCP63434.1	3.28e-110	1	157	1	157
AZC03054.1	3.28e-110	1	157	1	157
QCA01728.1	3.28e-110	1	157	1	157
ARG18035.1	3.28e-110	1	157	1	157
QPF41791.1	3.28e-110	1	157	1	157

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FIM_A	3.26e-39	1	157	1	148	Thestructure of Kbp.K from E. coli [Escherichia coli],7PVC_A Chain A, Potassium binding protein Kbp [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0ADE6	1.41e-38	1	157	1	148	Potassium binding protein Kbp OS=Escherichia coli (strain K12) OX=83333 GN=kbp PE=1 SV=2
P0ADE7	1.41e-38	1	157	1	148	Potassium binding protein Kbp OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=kbp PE=3 SV=2
Q9RVY3	2.44e-08	108	156	206	252	Uncharacterized protein DR_0888 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) OX=243230 GN=DR_0888 PE=1 SV=1
P54335	8.67e-07	106	157	159	219	Phage-like element PBSX protein XkdP OS=Bacillus subtilis (strain 168) OX=224308 GN=xkdP PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999819	0.000233	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002345_01503.