CAZyme Information: MGYG000002355_01929

Basic Information

• Species: Clostridium_F botulinum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_F; Clostridium_F botulinum
• CAZyme ID: MGYG000002355_01929
• CAZy Family: GT1
• CAZyme Description: Demethyllactenocin mycarosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393		44338.46	7.5723

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002355	3808262	Isolate	Italy	Europe

• Gene Location: Start: 1677296; End: 1678477 Strand: -

Full Sequence      

MSKIVFFSIPAHGHTNPTIAVVDELVKRGHEVWYYSFYEFQEKIETAGAKFIPCDNYLPE
LTPDIEKKVGKDFASLIEMAADMTMSLDEKVCRDLKEFQPNCIVSDSICIWGKLFAIKLN
VPYICSTTTFAMNKYTAKLIKQGLKEMFRMFIGIPRINKKIKMLQKKGYNVKNFISIIQN
DNDTDTIVYTSKEFQPMVETFSDKYAFVGPSFRVPEVEQIKKKYPLIYISLGTVLNQNIH
FYQNCIRALVDVDCQVIMSVGEKADIFSLGKLPDNFKVYPKVEQLEVLQHTDVFITHCGM
NSISESLYFGVPSVLFPLHSEQAMVANRVAELNAGKVLKSDAVNSIGETVLEVLNDISYK
RNAEVISKSLQKAGGASAAANKIEKVCNESTTK

Enzyme Prediction     

No EC number prediction in MGYG000002355_01929.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	12	385	2.5e-39	0.93717277486911

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01426	MGT	3.10e-100	7	385	1	388	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
COG1819	YjiC	2.69e-76	1	393	1	405	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03784	GT1_Gtf-like	4.84e-71	3	380	2	399	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
cd03785	GT28_MurG	2.52e-15	13	379	11	344	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam00201	UDPGT	1.15e-12	270	367	314	419	UDP-glucoronosyl and UDP-glucosyl transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJD26746.1	5.10e-284	1	393	1	393
ACO83590.1	7.24e-284	1	393	1	393
AUN07210.1	7.24e-284	1	393	1	393
CBZ03892.1	5.70e-281	1	393	1	393
APH18787.1	9.45e-280	1	393	1	393

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KQW_A	5.34e-60	4	384	6	382	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQX_A	6.07e-60	4	384	6	382	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
2IYA_A	1.02e-44	4	389	15	422	Thecrystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYA_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]
3IA7_A	3.69e-38	4	384	7	394	CrystalStructure of CalG4, the Calicheamicin Glycosyltransferase [Micromonospora echinospora],3IA7_B Crystal Structure of CalG4, the Calicheamicin Glycosyltransferase [Micromonospora echinospora]
3RSC_A	1.61e-34	2	384	21	409	CrystalStructure of CalG2, Calicheamicin Glycosyltransferase, TDP and calicheamicin T0 bound form [Micromonospora echinospora],3RSC_B Crystal Structure of CalG2, Calicheamicin Glycosyltransferase, TDP and calicheamicin T0 bound form [Micromonospora echinospora]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31853	5.13e-62	1	391	1	400	Uncharacterized UDP-glucosyltransferase YojK OS=Bacillus subtilis (strain 168) OX=224308 GN=yojK PE=3 SV=2
O34539	3.33e-59	4	384	6	382	NDP-glycosyltransferase YjiC OS=Bacillus subtilis (strain 168) OX=224308 GN=yjiC PE=1 SV=1
O05496	6.28e-56	1	372	1	375	Uncharacterized UDP-glucosyltransferase YdhE OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhE PE=3 SV=2
Q65JC2	7.36e-54	4	384	6	387	NDP-glycosyltransferase YjiC OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=yjiC PE=1 SV=1
Q9XC67	2.97e-39	1	384	58	454	Demethyllactenocin mycarosyltransferase OS=Streptomyces fradiae OX=1906 GN=tylCV PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002355_01929.