CAZyme Information: MGYG000002358_01876

Basic Information

• Species: Pelistega indica
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Pelistega; Pelistega indica
• CAZyme ID: MGYG000002358_01876
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
618	MGYG000002358_96|CGC1	69020.24	6.6246

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002358	2504912	Isolate	India	Asia

• Gene Location: Start: 22697; End: 24553 Strand: -

Full Sequence      

MQLVGLLDPSLQGSGQRRLWQKIKQLYYAQSLEMHWTKAQILEAYLNLVPLRGEVVGMPS
GAKTFFQKYTYALNKREASVLAAMLRAPNVSVSLLAKRACLLIESKTCDYMPDFIANAVN
SPQSYYLDNPEETPHYARALLSEYQKNKLTIPPVIRSTIDKKLQQYVKQRVHARLVELFQ
EKVSDAAVVVLDNNSGEILAYLGSSANLSNASQVDHVQALRQAGSTLKPFLYAQAFDNRL
LTAASLLNDSEMSVAVDTGLYIPQNYDKGFKGWVSVRTALASSLNIPAVQTLTMIGAEDF
RDELVALGLPLYESGDYYGYSLALGSADITLLSLTNAYRALANKGIYSPVQWINSEYSNP
HQSENRTKDTGKEIRVFSEQSAWIIQHILSDRTARTITFGLDSALSTPYHTAVKTGTSKD
MRDNWTIGWSPKYTVGVWVGNSAGESMRNISGVSGAAPIWHDVMDYLHKNNNVFFDPMPQ
GIVAKQVHYEPTVEADRQEFFIHGTEMDVVRLSQQSPHKDESDITTDVTVNTMISQPTDG
TIIAIDPDIPVSQQALKLAANNVNQQRADHIIWYLNGKEISRENPYYLPITTGKFTLELF
SIDGRKLDEVHFSVRGIR

Enzyme Prediction     

No EC number prediction in MGYG000002358_01876.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	13	90	1e-19	0.4350282485875706

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02073	PBP_1c	5.41e-162	1	605	90	718	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG4953	PbpC	1.97e-115	1	616	115	733	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	2.02e-81	1	470	59	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.27e-80	14	487	143	619	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
PRK11240	PRK11240	1.27e-65	1	482	119	582	penicillin-binding protein 1C; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHG64845.1	5.27e-189	1	616	141	735
AVL71553.1	2.25e-188	1	615	151	748
ASC89090.1	2.70e-185	1	616	117	711
QRF90334.1	2.17e-184	1	616	117	711
QHS36720.1	2.17e-184	1	616	117	711

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7U4H_A	2.05e-21	189	506	475	806	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
4OON_A	3.67e-19	169	487	379	742	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3DWK_A	1.43e-17	14	442	93	558	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
5FGZ_A	2.28e-17	14	460	222	686	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	2.34e-17	14	460	243	707	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76577	2.90e-45	1	482	121	580	Penicillin-binding protein 1C OS=Escherichia coli (strain K12) OX=83333 GN=pbpC PE=1 SV=1
P38050	8.23e-32	22	496	141	628	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
A7GHV1	7.68e-27	22	505	154	693	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
A7FY32	7.71e-27	22	505	154	693	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
A5I6G4	7.71e-27	22	505	154	693	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002358_01876.