CAZyme Information: MGYG000002366_04413

Basic Information

• Species: Salmonella enterica
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Salmonella; Salmonella enterica
• CAZyme ID: MGYG000002366_04413
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
190	MGYG000002366_1|CGC53	21377.21	10.2033

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002366	4955431	Isolate	United States	North America

• Gene Location: Start: 4568921; End: 4569493 Strand: +

Full Sequence      

MTFLSADAAEPPRASLQWRNEVIRTAREIWGLNAPVADFAGQLHQESGWAPDALSPAGAQ
GMAQFMPATAKWVSQLYPALRENKPFNPAWAIRALVQYDRQLWKSVSAKNSCQRMAFTLS
AYNGGQGWVNRDKKLAAAKGLDASIWFEHVERVNAGRSAANWRENRHYPKAILYQHAPRY
LQWGQASCIH

Enzyme Prediction     

No EC number prediction in MGYG000002366_04413.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	39	174	1.5e-17	0.7407407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13399	Slt35-like	5.79e-28	33	127	2	96	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
cd13403	MLTF-like	2.40e-23	40	167	16	137	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG4623	MltF	4.05e-17	2	187	259	446	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
cd00254	LT-like	3.60e-14	44	173	9	107	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	4.21e-14	13	182	134	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMY94791.1	1.01e-143	1	190	12	201
AMY90355.1	1.01e-143	1	190	12	201
ALO89239.1	1.01e-143	1	190	12	201
QQI85984.1	1.01e-143	1	190	12	201
AKF91829.2	1.01e-143	1	190	12	201

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6LU25	1.65e-06	3	167	282	431	Membrane-bound lytic murein transglycosylase F OS=Photobacterium profundum (strain SS9) OX=298386 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999611	0.000438	0.000002	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002366_04413.