CAZyme Information: MGYG000002401_00370

Basic Information

• Species: Propionibacterium freudenreichii
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Propionibacteriales; Propionibacteriaceae; Propionibacterium; Propionibacterium freudenreichii
• CAZyme ID: MGYG000002401_00370
• CAZy Family: GT2
• CAZyme Description: Glucans biosynthesis glucosyltransferase H

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
511		58188.06	10.1056

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002401	2630908	Isolate	United States	North America

• Gene Location: Start: 432590; End: 434125 Strand: -

Full Sequence      

MTKSPALYRVILLVWAALFGLALLTTAGSLSREITQRPVAGVLALVTLLSIGYFWLNGIK
DVLYTAWYYLVMRGRIRPVRRRELHRHPPRVVMVYCTRNDFNANSLAASMKQRYTNVHTV
ILDDSDKPEYLTMIDIFAATHDVQVVRRENHVGFKAGNLNNYLTGADYDYFVILDSDEII
PPRFIRRMLDYFASDRSIGIVQATHVATRNVTRFQQKFSLGVDSHWPVYQSVKNRYGFLS
LLGHGAMVSKQAFDAAGGFPLMVAEDLCFSLAVREHGYTTVFAPDVTCQEEFPVDYLAFR
KRHSKWTQGNMEFIRKNTRPIMTSRQLHWYEKLDIVLFTYALPLTAVFSVFVVINVVVLP
MMHASFQLPLWMLIPTVAFLVAPMVNDVVFHWAKMAHTKLLSYSGGSMMLYGSMYFTSLR
SSLKSMFGNSVFLVTPKDSTAISFREALRSTRSELIFAGVLAVISLVFTRSVFPVFLLVL
PAMVAPYLMVRHQPTRAELHERQRGKVLQAA

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	170	378	1e-25	0.9695431472081218

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06421	CESA_CelA_like	3.33e-35	90	312	1	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
COG1215	BcsA	2.05e-26	37	442	7	423	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06437	CESA_CaSu_A2	2.74e-26	117	309	33	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
cd06423	CESA_like	9.51e-23	103	266	13	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam13632	Glyco_trans_2_3	9.44e-18	170	374	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARO11435.1	0.0	1	511	1	511
CBH28874.1	0.0	1	511	1	511
CBL57431.1	0.0	1	511	1	511
CAO99134.1	0.0	1	511	1	511
CBI83408.1	0.0	1	511	1	511

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q84W54	1.64e-15	121	336	160	386	Probable glucomannan 4-beta-mannosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=CSLA1 PE=2 SV=1
P74165	1.22e-12	121	347	144	375	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
Q9U720	1.16e-08	155	312	600	763	Cellulose synthase catalytic subunit A [UDP-forming] OS=Dictyostelium discoideum OX=44689 GN=dcsA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000021	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29
34	56
336	358
368	390
455	477