CAZyme Information: MGYG000002455_01971

Basic Information

• Species: Bacteroides cellulosilyticus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides cellulosilyticus
• CAZyme ID: MGYG000002455_01971
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
777	MGYG000002455_7|CGC7	88484.14	6.0374

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002455	6974062	Isolate	United States	North America

• Gene Location: Start: 273851; End: 276184 Strand: +

Full Sequence      

MKIEKYFYGVCALCLLLSCQQAAKQVDTPVLPTKPFEMGEVVITKGPFKHAEEKETAYLL
ELEPDRFLSGFRSEAGLVPKAPKYEGWESLGVAGQTLGHYLSACAMYYATSGDERFLQRL
EYTINELDSCQQANGDGYLAATPDGKRIFKEVSAGKIYSQGFDLNGGWVPLYVMHKVLAG
LIDTYQYAHNERALAVAEKLANWMYGTFQHLTEEQMQKVLACEFGGMNEALANLYACTKN
EKFLALAQRFDNHKAIMDSLAVGVDDLEGKHANTQVPKIIGAARLYELTGSKRDSAIASF
FWHTVVQNHSYVNGGNSDGEHFGTPGQLNERLSTSNTETCNTYNMLKLTRHLFSWQSLPE
YSAYYERAVFNHILASQNPDDGMCTYYTPLISGGKKGYLSPFQSFCCCSGSGMENHVKYG
DFIYSEGSDSSLWVNLFIPSQLNWTDRKMIVTQDTDIPSSDKTVLTVKTEKPQSVIFRLR
YPEWAESMRIRVNGSSVSFEASNNSYVSIEREWKDNDKIEITFKIKFYTVSMPDNEKRVG
IFYGPVLLAGELGTEEPDMEKDIPVLVTNNQPVDKWLEKVSDSPLRFKTKGVGEPKDMSL
IPFYGMHHQHYMVYWDLFTTEEWKDMQEAYKNELKRLQDLDKITVDYVTLGEMQPERDHN
FRGEGIGNGVSHRKKWRAAWIGGWFEFDMKVLPDVPQDLHVTYWGGETAHLEFDIYVDGK
VLARQHLYQNKPNQFFEGVYSLPEHFWKGKEKITIRFKGVPGNWTGAIYNARIAKHE

Enzyme Prediction     

No EC number prediction in MGYG000002455_01971.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	41	549	2.2e-203	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	40	549	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.43e-126	41	604	12	571	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	3.69e-10	562	615	28	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT89366.1	0.0	1	777	1	777
ALJ59598.1	0.0	1	777	1	777
BAU55151.1	5.76e-271	29	776	41	789
ASU36278.1	2.15e-264	36	775	14	752
QCR22296.1	5.58e-264	20	775	34	790

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	3.57e-164	36	775	28	802	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	4.18e-159	36	775	28	802	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	2.79e-19	172	609	143	614	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
5MQO_A	2.39e-16	231	521	248	575	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000310	0.322644	0.676608	0.000149	0.000145	0.000127

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002455_01971.