CAZyme Information: MGYG000002467_04491

Basic Information

• Species: Yersinia frederiksenii_C
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yersinia; Yersinia frederiksenii_C
• CAZyme ID: MGYG000002467_04491
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
789	MGYG000002467_16|CGC1	85880.4	5.6257

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002467	4928795	Isolate	Finland	Europe

• Gene Location: Start: 2731; End: 5100 Strand: -

Full Sequence      

MTVIYKDAQYPISERVTDLLSRMTDEEKFAQMHAFWLILSADGLHKERTDMSDEFSGAGA
QASLQERIKLGIGQITRPLGTHIVDAREGVRAANKLQRTLIEETRLGIPALFHEECLVGL
LCKDATLFPSSLNYGSTWDLELVERAAAAIGQEARSTGCHQGLAPVLDVSRDVRWGRTEE
TFGEDPWLVGMMATHYVKGLQGKKRDLLATLKHYVGHSFSEGARNHAPVHLGFCELNDTF
LLPFEMAVKLANAGSVMPAYHDIDNQPGHSDSFLLTTVLREQWGFDGIIVADYGGVSLLH
QHHGVSHDAAESAALAFNAGLDVELPKDDCARHLREAVDRGLISMAKIDEIVSRVLKEKF
NLGLFEHPYADENAVELQSATTRQIARDVATRSITLLENNGILPLKGQPQVAVIGPTADD
PLALLSGYSFPVHLIISDMLEQTTQVTTPLQAMREQLGNDNVHYAKGCHIIEKRMAGAPV
FPGDSSNKPMQSSPVSTDTSLIPEAVRLASHSDVVVLCVGDLAGLFQSGTVGEGSDTDSL
SLPGVQQQLLDELVATGKPVVVVMTGGRPYNLGGQEDQVAALLMAWAPGQEGGYAIADIL
TGKAEPGGRLVVSVPKSAGAMPYYYNHKLKSGGTPFAFHFGARYPFGYGKTWTEFDYGQL
EQLSHEVVNEGGEVKVSLTVTNRGAQPGSEVVQLYVHDKVASMVRPVQELKAFQRVYLAP
GESARLTFHIPTDMLSFTRRDGQRVVEPGEFDIRVGASSDDIRSIGLIKVTGETRVLSGN
WRMVSHCIS

Enzyme Prediction     

EC	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	102	326	1.1e-63	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	9.45e-171	16	764	38	759	beta-glucosidase BglX.
COG1472	BglX	7.09e-86	23	421	1	367	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	9.38e-78	54	356	13	314	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	6.15e-69	105	756	78	769	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	8.19e-57	394	649	1	213	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATM94524.1	0.0	1	789	1	789
AYN30049.1	0.0	1	787	1	787
BCG09748.1	0.0	1	787	1	787
CCO21524.1	0.0	1	787	1	786
AMO49219.1	0.0	1	787	1	786

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	3.79e-136	19	764	17	746	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	2.08e-135	19	764	17	746	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5Z87_A	1.30e-123	88	763	103	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5YOT_A	3.90e-119	5	763	7	749	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
5Z9S_A	8.54e-119	2	759	14	775	Functionaland Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum],5Z9S_B Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P33363	5.04e-115	16	763	38	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	2.88e-113	16	763	38	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH0	1.12e-111	105	767	62	720	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	1.31e-111	5	763	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	1.76e-79	12	762	35	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002467_04491.