CAZyme Information: MGYG000002496_02532

Basic Information

• Species: Salmonella bongori
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Salmonella; Salmonella bongori
• CAZyme ID: MGYG000002496_02532
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
160		18318.52	10.0518

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002496	4572147	Isolate	Italy	Europe

• Gene Location: Start: 50158; End: 50640 Strand: +

Full Sequence      

MRYFFTIIIWLLSMSPAWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGRNRDGSTD
IGLMQINSSHMKRLKKMGVSEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGT
SPKRAEIRKRYAKKVWENYKKLKEMPAEEKNKKLTIALQK

Enzyme Prediction     

No EC number prediction in MGYG000002496_02532.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	22	145	1.7e-23	0.9037037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15328	PRK15328	5.44e-103	1	160	1	160	type III secretion system invasion protein IagB.
cd13400	LT_IagB-like	3.68e-57	29	141	1	109	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	2.52e-36	22	137	1	113	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK13722	PRK13722	1.25e-21	20	151	21	159	lytic transglycosylase; Provisional
cd00254	LT-like	1.16e-17	34	140	2	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGR60086.1	5.85e-110	1	160	1	160
QXY82812.1	5.85e-110	1	160	1	160
QQP76084.1	3.39e-109	1	160	1	160
ASG53687.1	3.39e-109	1	160	1	160
CCC31554.1	3.39e-109	1	160	1	160

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	2.92e-14	20	104	2	87	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P43018	9.16e-99	1	160	1	160	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1
E1WAC2	5.30e-98	1	160	1	160	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	5.30e-98	1	160	1	160	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1
Q07568	3.45e-38	19	139	18	138	Protein IpgF OS=Shigella flexneri OX=623 GN=ipgF PE=3 SV=1
Q55287	9.80e-38	19	139	18	138	Protein IpgF OS=Shigella sonnei OX=624 GN=ipgF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.026553	0.947123	0.025260	0.000353	0.000313	0.000361

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002496_02532.