CAZyme Information: MGYG000002516_01006

Basic Information

• Species: Proteus vulgaris
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Proteus; Proteus vulgaris
• CAZyme ID: MGYG000002516_01006
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
223	MGYG000002516_1|CGC11	24769.03	9.9198

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002516	3639158	Isolate	Denmark	Europe

• Gene Location: Start: 1059505; End: 1060176 Strand: -

Full Sequence      

MKSKIIFSLGMLLLAGCADNTHQTAQRESPRFLNQKTTDNRVNNASISTAQWKATPFDSH
IQQASSRYNVDETLIKAIIQVESNFRPEVISKSNAVGLMQIKASTAGRDVYQNRGKAGQP
TTAQLKDPATNIDLGTAYIRLLRERHLAGIIDPETLYYATILAYVNGAGALLRTFDKDRN
NAIAKINSMSADDFYRYVEKNHPASQAPRYLAKVKAAYHGVDY

Enzyme Prediction     

No EC number prediction in MGYG000002516_01006.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	71	220	1.2e-21	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16893	LT_MltC_MltE	1.96e-79	61	219	3	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK15470	emtA	1.42e-68	7	217	6	199	membrane-bound lytic murein transglycosylase EmtA.
PRK11671	mltC	9.61e-62	61	217	196	352	membrane-bound lytic murein transglycosylase MltC.
pfam01464	SLT	6.12e-27	61	186	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	6.94e-24	53	215	135	292	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYY80383.1	8.40e-159	1	223	1	223
VTP88867.1	8.40e-159	1	223	1	223
ATN00782.1	1.11e-138	1	222	1	222
QNH64416.1	2.24e-138	1	222	1	222
QGW02974.1	3.19e-138	1	222	1	222

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Y8P_A	5.52e-58	62	217	27	182	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
3T36_A	7.30e-58	62	217	44	199	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]
6GHY_A	1.57e-57	62	217	27	182	Structureof Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12],6GHY_B Structure of Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12]
6GI3_B	1.57e-57	62	217	27	182	Structureof Lytic Transglycosylase MltE mutant S73A from E.coli [Escherichia coli]
6GI4_B	1.57e-57	62	217	27	182	Structureof Lytic Transglycosylase MltE mutant S75A from E.coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B7LSJ1	7.57e-60	7	217	6	199	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73) OX=585054 GN=emtA PE=3 SV=1
B7UQ77	1.99e-57	62	217	44	199	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) OX=574521 GN=emtA PE=3 SV=1
B7NUV4	4.00e-57	62	217	44	199	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) OX=585057 GN=emtA PE=3 SV=1
B7MTX1	4.00e-57	62	217	44	199	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli O81 (strain ED1a) OX=585397 GN=emtA PE=3 SV=1
Q1RCQ2	4.00e-57	62	217	44	199	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli (strain UTI89 / UPEC) OX=364106 GN=emtA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000063	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002516_01006.