CAZyme Information: MGYG000002532_00357

Basic Information

• Species: Enterovibrio hollisae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Enterovibrio; Enterovibrio hollisae
• CAZyme ID: MGYG000002532_00357
• CAZy Family: GT25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
247	MGYG000002532_1|CGC3	28514.08	7.8171

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002532	4096279	Isolate	not provided	not provided

• Gene Location: Start: 362563; End: 363306 Strand: +

Full Sequence      

MSVSNVYVISLKRSVERREKIAKEMAEKNIAFTFFDAVDGHLGEPELAADYDYRKRLWLT
SGKMPNKGELGCYASHYALWLKCIELGEPIIICEDDIELHENAKSIVEYALMAANEYGFI
RMQSVCKGSATTEVIKDGEFSLHLMRDNYGGLCAYAISPKAASRLIKHRWCFPVDCFVGA
NYIHGQYSYQLEPCFMADHIGNESTIQFEKMEKPPFYRKLSRELYTLYKKIMLSIMYWKK
CRALNVK

Enzyme Prediction     

No EC number prediction in MGYG000002532_00357.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	5	177	7.1e-40	0.9779005524861878

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06532	Glyco_transf_25	9.13e-39	6	177	2	127	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
pfam01755	Glyco_transf_25	1.03e-38	6	178	4	200	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.
COG3306	COG3306	3.23e-31	6	231	5	242	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMG29804.1	2.24e-184	1	247	1	247
AYK16552.1	7.92e-76	6	235	3	229
QIF42620.1	2.25e-75	6	235	3	229
ANB53507.1	1.29e-74	6	240	3	234
BBT93379.1	1.29e-74	6	240	3	234

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q57394	3.47e-12	7	168	5	169	Lipooligosaccharide biosynthesis protein lic2B OS=Haemophilus influenzae OX=727 GN=lic2B PE=3 SV=1
Q57125	3.57e-11	7	178	35	203	Putative glycosyltransferase HI_0765 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0765 PE=3 SV=1
A7MB73	6.06e-10	1	178	317	503	Probable inactive glycosyltransferase 25 family member 3 OS=Bos taurus OX=9913 GN=CERCAM PE=2 SV=1
Q5U309	8.04e-10	1	178	294	480	Probable inactive glycosyltransferase 25 family member 3 OS=Rattus norvegicus OX=10116 GN=Cercam PE=2 SV=2
Q03974	1.20e-09	1	247	1	282	Lipooligosaccharide biosynthesis protein lex-1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=lex1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002532_00357.