CAZyme Information: MGYG000002561_00652

Basic Information

• Species: Bacteroides sp902388495
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902388495
• CAZyme ID: MGYG000002561_00652
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406	MGYG000002561_3|CGC5	45892.11	6.8153

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002561	4554549	MAG	China	Asia

• Gene Location: Start: 269076; End: 270296 Strand: -

Full Sequence      

MKSKTILLIASLCLIGSACKQPTEGFSVDTNIDYCKSQALRTLAVIPSDTKKEIPNSIDA
DSINWHYTNPGSWTSGFWPGILWYLYENTKDGIWKTAAENYTQMILPTTHKKARSHDVGF
ITMCSLGNGYRLTGNMEYKEGLLRAADSLAVLFNPKVGTLLSWPNMVKKENWPHNTIIDN
MMNLELLFWAARNGGDHHLYDIACSHADTTMKYHFRKDYSCYHVAVYDTLTGNFIKGVTH
QGLSDDSMWARGQAWAIYGYTMAYRETKEARFLDFAKKITDVYLSRLPESLIPYWDFDAP
EISPAEPKDASAAAITASALLELSTYVSDRDSSHYYYEKAKEILEALSSPAYKAGNKKDA
FLLHSVGHMPNGGEVDASIIYADYYYLEALTRFKRLQEKRSILANL

Enzyme Prediction     

No EC number prediction in MGYG000002561_00652.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	69	393	3.6e-128	0.9848024316109423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	4.30e-10	45	271	1	212	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT92211.1	1.08e-255	1	406	1	406
ALJ62038.1	1.08e-255	1	406	1	406
ABR37867.1	4.25e-221	1	406	1	408
QQY39801.1	4.25e-221	1	406	1	408
QJR77955.1	8.57e-221	1	406	1	408

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	3.76e-92	1	398	1	393	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	3.37e-56	73	393	68	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	3.45e-56	73	393	69	390	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	9.51e-56	73	393	69	390	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]
3ANI_A	1.87e-55	73	393	69	390	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	4.30e-84	66	396	70	397	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q8DR77	1.36e-59	51	393	46	388	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q9A0T3	6.12e-58	20	393	14	391	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q8E372	1.89e-55	73	393	69	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q9RC92	2.03e-51	60	395	28	366	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000100	0.023938	0.975947	0.000016	0.000022	0.000016

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002561_00652.