CAZyme Information: MGYG000002565_01150

Basic Information

• Species: Veillonella_A magna
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; Veillonella_A; Veillonella_A magna
• CAZyme ID: MGYG000002565_01150
• CAZy Family: GT28
• CAZyme Description: Processive diacylglycerol beta-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388	MGYG000002565_64|CGC1	43411.37	5.6316

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002565	1964232	MAG	China	Asia

• Gene Location: Start: 8467; End: 9633 Strand: +

Full Sequence      

MRDMKKHRKVLIVSASIGTGHTQAARAIEEYWMQQSPDTEITHVDFLATDTLSFDNLLKE
TYIKMIDVFPMMYDLVYRFSQGERKGGMIQTVLSWLLKRRMLRLIRQESPDVVIFTHPFP
CGAACILKRQNLIDVPLIGVITDFAVHQFWVYPQLDAYYVGTEVMVDELVKAGIDCSKIH
VTGIPVRRHFFDKAIAQYALTKPVRVLVMGGGLGLGSLESALQRLDEVAAIDEFTVVTGR
NTSLYEALLDMKERMQTPVRVYGYTTDIPELMAEAALLVTKPGALTCMEAVTVGIPMVFF
NAIPGQEEANALLLEQKGCARWARDIHNLEDVVTALLINPERLQNMSQQARAWHVDGAAN
IVSSVEAMLSAKCTFETIGDLQENTPQG

Enzyme Prediction     

No EC number prediction in MGYG000002565_01150.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	206	354	7.5e-34	0.9617834394904459

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd17507	GT28_Beta-DGS-like	1.23e-89	10	362	1	355	beta-diglucosyldiacylglycerol synthase and similar proteins. beta-diglucosyldiacylglycerol synthase (processive diacylglycerol beta-glucosyltransferase EC 2.4.1.315) is involved in the biosynthesis of both the bilayer- and non-bilayer-forming membrane glucolipids. This family of glycosyltransferases also contains plant major galactolipid synthase (chloroplastic monogalactosyldiacylglycerol synthase 1 EC 2.4.1.46). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK13609	PRK13609	1.34e-61	4	362	1	361	diacylglycerol glucosyltransferase; Provisional
COG0707	MurG	1.72e-50	9	367	1	353	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
PRK13608	PRK13608	3.72e-49	4	356	2	355	diacylglycerol glucosyltransferase; Provisional
pfam06925	MGDG_synth	1.58e-29	21	186	1	169	Monogalactosyldiacylglycerol (MGDG) synthase. This family represents a conserved region of approximately 180 residues within plant and bacterial monogalactosyldiacylglycerol (MGDG) synthase (EC:2.4.1.46). In Arabidopsis, there are two types of MGDG synthase which differ in their N-terminal portion: type A and type B.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEG93043.1	1.13e-196	5	378	4	377
BBU34013.1	7.24e-196	5	378	4	377
BBU35939.1	8.40e-195	5	378	4	377
ARF99712.1	2.05e-192	5	378	4	384
QQB17499.1	2.38e-191	8	378	7	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WYI_A	3.39e-28	3	350	1	364	Thecrystal structure of Arabidopsis thaliana galactolipid synthase, MGD1 (apo-form) [Arabidopsis thaliana],4X1T_A The crystal structure of Arabidopsis thaliana galactolipid synthase MGD1 in complex with UDP [Arabidopsis thaliana]
7D1I_A	2.35e-12	3	351	5	347	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
1F0K_A	1.81e-07	181	369	158	357	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
3S2U_A	2.42e-07	182	352	158	337	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B7HU46	8.97e-51	4	367	1	367	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus cereus (strain AH187) OX=405534 GN=ugtP PE=3 SV=1
B9J2U2	8.97e-51	4	367	1	367	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus cereus (strain Q1) OX=361100 GN=ugtP PE=3 SV=1
A9VSQ8	8.97e-51	4	367	1	367	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus mycoides (strain KBAB4) OX=315730 GN=ugtP PE=3 SV=1
B7H9Q4	1.26e-50	4	367	1	367	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus cereus (strain B4264) OX=405532 GN=ugtP PE=3 SV=1
Q81IA1	1.76e-50	4	367	1	367	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=ugtP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999839	0.000195	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002565_01150.