CAZyme Information: MGYG000002568_01788

Basic Information

• Species: Phocaeicola sp900542985
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900542985
• CAZyme ID: MGYG000002568_01788
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
432	MGYG000002568_31|CGC1	48268.67	4.6465

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002568	2891879	MAG	China	Asia

• Gene Location: Start: 14739; End: 16037 Strand: -

Full Sequence      

MKHSMKYAAMAALTAMCLSCTTKQPNPLAKEILNNPDLQVVDSMGRSILSQGFNAGSGYS
QVWARDMNTFIETACEVVNPEEIRGALLVFFALQQPNNEMIDGYVLKGEFNWGDPRPYYS
DAAPDHVGFKNTVETDQETSLIQIIGKYIRKTGDKSILKEVVNGQTVYERMVKMIDYLMT
EKYDSKYGLLTGALTSDWGDVQANDDEMVDISENSVVTIDAYDNAMFAIALGYMAEMSEG
EDKAKWEKMRKEIVANTRKHLWDEAANKIIPHVYPNGTPDFVDFDENKIHYHGGTAIAIE
AGILEHDEIGIVNAQMVRNVQQSGMPSIGLTVYPPYPEGFFRGGMAKAYVYQNGGDWTWF
GGRMIQQLIANGYIEEAYAEITPMIDRVIKNKGFYEWYGQGGVPSGSGHFKGSAGVLCKA
IEMLREWAENNK

Enzyme Prediction     

No EC number prediction in MGYG000002568_01788.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	62	347	7.5e-16	0.4642857142857143

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17167	Glyco_hydro_36	1.64e-08	78	263	66	248	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.
pfam17389	Bac_rhamnosid6H	1.02e-07	150	265	112	217	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3459	COG3459	1.01e-04	78	291	627	830	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
COG3408	GDB1	3.25e-04	43	404	266	575	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SCM56873.1	3.80e-132	5	429	1	431

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000033	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002568_01788.