CAZyme Information: MGYG000002582_00318

Basic Information

• Species: Succinivibrio sp900552905
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Succinivibrionaceae; Succinivibrio; Succinivibrio sp900552905
• CAZyme ID: MGYG000002582_00318
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
442		49190.28	7.6581

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002582	1765105	MAG	China	Asia

• Gene Location: Start: 66508; End: 67836 Strand: +

Full Sequence      

MTNKNHPHLYALIAGENSGDTLGAGLMKALRRHDPKAQFIGVGGPKMIALGLNSEANMED
LAVMGIVEVLVHLPKILSIRNKVTRRIIEARPCVLIGIDAPDFNLTVEMRVRAAGIPTIH
YVSPSVWAWREGRMKKIRRACDCVLALLPFEKDFYDKQQLKCVYVGHTLANTIPLKMDQE
NARLSIDLYRTCVENIEPHKTKIMGILPGSRYGVISNMLPVYAQVARMVKEKLHDIVFIS
SVPSYTHAQLLKDAWLEHAPDLSLTIYVGNTLDMMASCDAILLTSGTVALEVTLAKIPFC
VAYKVNPLTAALARRLLKVDTFSLPNLISGHKVVSEYIQENCTAENLTAEMVKLLTSDNL
LMKKEFYKIHEAIRCNSDELAANAVFDVIKACGHNYSEEEEAEHQNYLKVNANANRANIE
PEVTLPDASVIKSSKDKTEPKF

Enzyme Prediction     

No EC number prediction in MGYG000002582_00318.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	11	374	6.3e-121	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.30e-168	11	390	5	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.57e-141	11	391	5	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.60e-120	11	385	2	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	5.24e-112	11	387	9	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK01021	lpxB	4.03e-53	6	338	225	551	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSX31084.1	1.44e-115	4	385	3	375
QIJ05384.1	8.46e-115	4	385	3	375
QWL03673.1	2.40e-114	4	385	3	375
BCV37365.1	3.39e-114	4	385	3	375
QSX41865.1	6.58e-114	4	385	3	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.01e-99	4	388	3	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	5.67e-99	4	388	3	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B1KNT0	3.61e-114	1	391	1	381	Lipid-A-disaccharide synthase OS=Shewanella woodyi (strain ATCC 51908 / MS32) OX=392500 GN=lpxB PE=3 SV=1
Q8EGG2	2.12e-113	9	389	8	379	Lipid-A-disaccharide synthase OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=lpxB PE=3 SV=1
Q0HT75	4.24e-113	9	391	8	381	Lipid-A-disaccharide synthase OS=Shewanella sp. (strain MR-7) OX=60481 GN=lpxB PE=3 SV=1
Q0HGW8	4.24e-113	9	391	8	381	Lipid-A-disaccharide synthase OS=Shewanella sp. (strain MR-4) OX=60480 GN=lpxB PE=3 SV=1
A0KZ10	1.20e-112	9	391	8	381	Lipid-A-disaccharide synthase OS=Shewanella sp. (strain ANA-3) OX=94122 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002582_00318.