CAZyme Information: MGYG000002584_00478

Basic Information

• Species: Akkermansia sp900545155
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia sp900545155
• CAZyme ID: MGYG000002584_00478
• CAZy Family: CBM38
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1085	MGYG000002584_3|CGC3	119348.5	7.415

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002584	3044716	MAG	China	Asia

• Gene Location: Start: 83585; End: 86842 Strand: -

Full Sequence      

MIVPTILTRKKLFVHAIAVWGTVVVQAAGVYPNEAVVPVDKKLSPEWVASLTDRGQLTTV
SSGPGLSHVGMPVGGLFCGTVYLGGDGKLWLWDVFNDNRQGVMPRSLVWNGARIRSRDGA
SYVHPDSAQPSPFRKGFPEELQKSAKSGDDEFSGQEQMEQGFAIKVGDHVRTMDRNGWNR
VAFTGTYPIGTVDYSDQNFPVSVRLEAFSPFIPLNTDDSSLPCTVMSFTIRNCTDRTVNG
TIGGWLKNAVCCNSGTGLGMRVNKADPNGGMPHVLMTAEEGGWVAVPGREDVSFEDFERE
DYAGWKVEGTAFDKTPLDNARIPPYMGDIGMHGSRAAVSHNVRMGGDVMAGDSHTGSLLS
PEFTIDREFIRFSIAGGRKPGREKEGGTGIELLVDGKAVCSATGHNSNRLRPDAFPVKDY
IGKKARLRIYDGAQGSWGNIIVDHIVFSDSPAPPARPLKEEADFGSFCFALASPGKGTRA
MTSLPARNTEQALFGMDGSQPSVGNVRFDKDKPLGGLTRDFSIPAGESVQVDFILAWYFP
NIYLNTMGDTGRPDTDGKKGRRHYAARFSNANDVASYVADHWKSLVGGTKLWRDTWYDSS
LPFWFLDRTFANTSTLATTTSHRLTNGRFYAWEGVGACEGTCTHVWQYAQAPARLFPDIE
RVTRDRVDLGIGFHPETGGIGMRAEHNRQPAIDGQCGRIMGIWREHTMSADDSFLNKVWP
RAKKAVQYVLDHDRDGDGILDGAQENTLDAAWYGEIAWTSIEALGAFKAGEEMALAVGDG
EFAKLCRDRREKGRKAVEARLFNGKWFIQKKDEAHPNVFGTYNGSFIDQLFGQSMAYQCG
LGELISPDRQKKALRSIWDNNFSPDLTEYLKHVRPLGRPYYVEGEGGTLMCTNALNESDP
YKGSSWTHGYLNECMSGFEHQLASHMMRAGMVKKALAVTRAIHDRYSAEKRNPYNEIECS
DHYARAMASYGTFLSACGYDYNGPEGKLGFNPRMSPENFKAAFTTAEGWGTYSQKKQGNA
WTAGVALKYGQLTLRELKLAFPLKKVRVTVDGKPAPDFKVEKGVLVWGTPLTLKAGQTLT
VQTGA

Enzyme Prediction     

No EC number prediction in MGYG000002584_00478.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH116	682	970	1.1e-51	0.7493112947658402
CBM38	295	432	2.2e-26	0.9689922480620154

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04685	DUF608	9.43e-37	693	971	99	361	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.
COG4354	COG4354	3.93e-29	510	971	243	712	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].
pfam12215	Glyco_hydr_116N	3.17e-19	70	250	1	148	beta-glucosidase 2, glycosyl-hydrolase family 116 N-term. This domain is found in bacteria, archaea and eukaryotes. This domain is typically between 320 to 354 amino acids in length. This domain is found associated with pfam04685. It is found just after the extreme N-terminus. The N-terminal is thought to be the luminal domain while the C terminal is the cytosolic domain. The catalytic domain of GBA-2 is unknown. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335 in the downstream family pfam04685.
COG3459	COG3459	8.26e-04	756	865	759	862	Cellobiose phosphorylase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQT69739.1	1.26e-307	37	1084	44	1042
AIE85581.1	2.53e-290	37	1079	40	1045
QEH34265.1	8.86e-287	37	1081	56	1052
AMV37336.1	7.01e-285	34	1056	51	1015
QEH32152.1	2.73e-272	34	1081	70	1089

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BVU_A	1.07e-06	699	861	524	685	Crystalstructure of Thermoanaerobacterium xylolyticum GH116 beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],5BX2_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with 2-deoxy-2-fluoroglucoside [Thermoanaerobacterium xylanolyticum LX-11],5BX3_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with deoxynojirimycin [Thermoanaerobacterium xylanolyticum LX-11],5BX4_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with Glucoimidazole [Thermoanaerobacterium xylanolyticum LX-11],5BX5_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with glucose [Thermoanaerobacterium xylanolyticum LX-11],5NCX_A Crystal structure of Thermoanaerobacterium xylolyticum GH116 beta-glucosidase with an covalent inhibitor [Thermoanaerobacterium xylanolyticum LX-11],5OST_A Beta-glucosidase from Thermoanaerobacterium xylolyticum GH116 in complex with Gluco-1H-imidazole [Thermoanaerobacterium xylanolyticum LX-11]
5FJS_A	1.07e-06	699	861	520	681	Bacterialbeta-glucosidase reveals the structural and functional basis of genetic defects in human glucocerebrosidase 2 (GBA2) [Thermoanaerobacterium xylanolyticum LX-11],5FJS_B Bacterial beta-glucosidase reveals the structural and functional basis of genetic defects in human glucocerebrosidase 2 (GBA2) [Thermoanaerobacterium xylanolyticum LX-11],5O0S_A Crystal structure of txGH116 (beta-glucosidase from Thermoanaerobacterium xylolyticum) in complex with unreacted beta Cyclophellitol Cyclosulfate probe ME711 [Thermoanaerobacterium xylanolyticum LX-11]
5NPF_A	1.07e-06	699	861	523	684	Crystalstructure of txGH116 (beta-glucosidase from Thermoanaerobacterium xylolyticum) in complex with beta Cyclophellitol Cyclosulfate probe ME594 [Thermoanaerobacterium xylanolyticum]
7DKS_A	1.07e-06	699	861	524	685	ChainA, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKT_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKU_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKV_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11]
7DKW_A	1.07e-06	699	861	524	685	ChainA, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKW_B Chain B, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKX_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKY_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q69ZF3	9.18e-07	699	843	616	758	Non-lysosomal glucosylceramidase OS=Mus musculus OX=10090 GN=Gba2 PE=1 SV=2
Q7KT91	1.60e-06	714	935	687	891	Non-lysosomal glucosylceramidase OS=Drosophila melanogaster OX=7227 GN=CG33090 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.030038	0.966209	0.000567	0.002476	0.000385	0.000303

TMHMM  Annotations     

start	end
12	31