CAZyme Information: MGYG000002587_01365

Basic Information

• Species: Parabacteroides sp900760525
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900760525
• CAZyme ID: MGYG000002587_01365
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
158		18057.28	7.5495

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002587	4423098	MAG	China	Asia

• Gene Location: Start: 50601; End: 51077 Strand: -

Full Sequence      

MDNKINFLHTCRKAASEAEKQFGMNARIILAQGALESGWGTSLLAAEHHNFFGMMGYGAS
NAYWHGQRATFETAYGTHHFRHYDSPLLSFLDFARLIRSAYPRAYHFSFQPEAYAKEIAY
SPYISEQNGDNRDLYRRNIVVLEAEIGRLLDWNAKLAA

Enzyme Prediction     

No EC number prediction in MGYG000002587_01365.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	13	127	1.1e-21	0.859375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF038016	sporang_Gsm	3.48e-18	7	123	163	289	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
pfam01832	Glucosaminidase	4.70e-18	13	101	2	90	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
COG1705	FlgJ	1.99e-16	2	99	41	140	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK12713	flgJ	2.44e-12	2	126	179	312	flagellar rod assembly protein/muramidase FlgJ; Provisional
PRK12711	flgJ	4.00e-12	15	103	226	318	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALB75641.1	1.74e-96	1	151	1	151
QUT50521.1	1.74e-96	1	151	1	151
ALB76004.1	2.36e-96	1	151	1	151
QUT50226.1	2.54e-69	1	158	1	159
QUT50705.1	3.91e-44	4	146	5	147

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002587_01365.