CAZyme Information: MGYG000002593_01168

Basic Information

• Species: Limosilactobacillus sp900557215
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus; Limosilactobacillus sp900557215
• CAZyme ID: MGYG000002593_01168
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
651		75381.33	5.0399

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002593	1475799	MAG	China	Asia

• Gene Location: Start: 19897; End: 21852 Strand: -

Full Sequence      

MNKYWIWFPGDFEIHEGMLQNFTREERGMRWPAYWYIDDCYKNIKFEKTYDLAEPTTFTV
HTHQQGYITINDIKYHVNEPITLDAGKQSIVIYIFSPDELPTIYIEGDVIYSDPSWVADN
YVIQRPVGYSKLFTELSDNPAKIPYHHQTIQPVSMTNINNGLLVDFGKEINAALIFKNLT
APITVCYGESKAEALDTKMCYYQQSNITDQSKIAKRAFRYLFIPNYSANSINVVADCIYL
PMQNKSSFNSDDELLNNIWQASIRTFKLCSEVFYIDGIKRDRWIWGGDAYQDNYINQYSF
FNEDVDKRTIIALRGHDEVLQHINTIVDYSLLWVISIYNHYEMTADTEFLQMIMPRMEKM
MQYLLNQTNDLGFIYGRQGDWIFVDWSEMDKDGTVAAEQMFLLQALKAIITAKKALNQDT
SNYENRFNTLKENTVKYFWDNEQGAFIDSYESGKHHVTRHANILAILFNIVDDDKKQQIL
HNVLLNDQITQLTTPYFKFFEQDALCQLGQLKTVYDTIKDYWGSMIKKGATTIWEEYDPS
VTGKQQFAMYGDPFGKSLCHAWGSSPVYLLGRYFMGLQPTSAGYSTFEVAPHLTMFEHLD
CTLPIKGGSVHFRVHDGQVDITTDRPGGTVVTGKEKILLQPNQAVTITNEN

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	161	631	1.5e-98	0.9761904761904762

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	5.67e-25	246	573	4	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam06202	GDE_C	2.13e-08	324	496	81	267	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
COG3408	GDB1	0.002	325	480	336	503	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EFL96112.1	0.0	1	647	1	650
AZP90497.1	0.0	1	647	1	650
ARW26209.1	0.0	1	647	1	650
QAR86697.1	0.0	1	647	1	650
ARW24178.1	0.0	1	647	1	650

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	4.03e-140	5	611	20	673	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	1.40e-36	162	608	439	910	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	1.76e-34	250	573	211	541	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	7.39e-16	141	617	617	1116	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002593_01168.