CAZyme Information: MGYG000002594_01941

Basic Information

• Species: Streptococcus sanguinis_H
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sanguinis_H
• CAZyme ID: MGYG000002594_01941
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
232		25846.57	4.8399

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002594	2166519	MAG	China	Asia

• Gene Location: Start: 4557; End: 5255 Strand: +

Full Sequence      

MKKRISKKGKRILSALFIMTTTIAVGFVLAKHINPASANNSDQQPMNQTDYFISQIGEPA
RQLGQDNDLYASVMIAQAILESGSGQSSLSGEPHYNLFGIKGHYDGQSANLETWEDDGEG
NAYTINDSFRSYPSYVESLQDYVSVLKQGHFAGAWKSNAPTYQDATAALTGVYATDTSYN
AKLNYIIEKYDLTRFDSPLYESGAGYIVYNPYRQQYTTQDILDVDTAWANRF

Enzyme Prediction     

No EC number prediction in MGYG000002594_01941.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	58	192	2e-28	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK08581	PRK08581	2.26e-59	20	202	294	484	amidase domain-containing protein.
PRK06347	PRK06347	3.55e-54	35	197	133	304	1,4-beta-N-acetylmuramoylhydrolase.
COG1705	FlgJ	6.33e-54	8	196	1	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	4.37e-20	52	196	11	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
NF038016	sporang_Gsm	3.30e-18	52	196	163	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VDY71773.1	4.86e-167	1	232	1	232
QLB50188.1	2.92e-166	1	232	1	232
ABN44508.1	3.99e-166	1	232	1	232
SQF34709.1	5.67e-166	1	232	1	232
SQF71375.1	1.63e-165	1	232	1	232

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T1Q_A	1.28e-43	34	196	40	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3FI7_A	3.69e-42	27	196	10	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN5_A	2.33e-18	52	189	6	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	3.28e-18	52	189	6	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37710	4.07e-45	52	211	183	348	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q2G222	5.19e-42	34	196	300	472	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
P39046	2.42e-39	6	205	15	223	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
P0C2T5	2.67e-39	3	205	11	220	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
A2RHZ5	3.72e-39	43	205	56	220	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.101179	0.870691	0.026929	0.000471	0.000320	0.000364

TMHMM  Annotations     

start	end
12	30