CAZyme Information: MGYG000002602_01828

Basic Information

• Species: CAG-274 sp900545305
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; CAG-274; CAG-274; CAG-274 sp900545305
• CAZyme ID: MGYG000002602_01828
• CAZy Family: PL9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
888	MGYG000002602_13|CGC1	94884.71	4.5699

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002602	2192997	MAG	China	Asia

• Gene Location: Start: 9812; End: 12478 Strand: -

Full Sequence      

MKRLKKSVATVLAFVMVWSLMSLQSFGATITKSTTWDFTKWTAQTLTNDYSYDNLTVTAT
STKKVSINSGINLGGGGAVDYRSIVFTATGPCTISVNAKGGSTTRYLVLANSNGAEYGRI
ATGSSYGTGTFNYTGVGENLYIYSAGSGITLSSMSLTYSTTAHKKGDVNNDGKVDKADAA
IVLKHISGVSTITDADQLAAANYNNDGVVNALDAVAILNNQYVPEETTETTTEGVALDTV
AGYEPSGITPDGVAEVVYQSDTDDYLLKDTSTNCSATWKNSFETISSGKVTIAGYATPSK
ASSKWAFTRILGTDSEGNSVYFALGTDADKNISLCLSDGTYVSTDLAITANQKYTYEFVV
DLDMGAVQLTVNGKTVTSPITAKSINAVYNVTAVSDNARNLTVSKPVVKLGSDVVITTTT
ETTTETTTTTTTETTTVNTADGVEVKDYSSLATALNTANAKIYVMNDIDCGDQIKLSKGE
QSIIGVPDENGVLPVLNFENMVGKGTDIINASSSDGDVGLRITSKNNVVRNLVIEYAHDN
GIQIKGSEVTGNEVKNCILRYNNDSGMQITGGAYNNAVENIYSYRNCDVYTLGSNADGFA
VKLSAGPEEVTSASEFQNSKNTFVNCYSWENSDDGWDSFDYPSSKQNFNPNRWTYKNVYE
NCICWGNGSAPLQLGYTDYVNGKTLDENLPVIRRIKALVSSDVYDSFVSDYNNGNLGSRT
MSSSTYLSTLDSKLSVSIPSSKGTLSITGYCSSSNWGGNPNGFKLGSAYTQSISERTLVN
CISFDHASAGFDKNNAKCNVELKNCLSFDNGYNYHLSGTTAKAFSNVLGWNYSKSDDLPT
AGSGVTVKVSKPSNYSTIETNVRNAADELVSWAKNNTVNPSGIFSQIF

Enzyme Prediction     

No EC number prediction in MGYG000002602_01828.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL9	489	839	1.6e-36	0.6666666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14256	Dockerin_I	8.91e-14	165	219	1	54	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
pfam00404	Dockerin_1	4.90e-10	166	221	1	54	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.
cd14254	Dockerin_II	3.35e-07	166	220	1	52	Type II dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type II dockerins, which are responsible for mediating attachment of the cellulosome complex to the bacterial cell wall.
cd14255	Dockerin_III	1.26e-05	166	218	1	57	Type III dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. Two specific calcium-dependent interactions between cohesin and dockerin appear to be essential for cellulosome assembly, type I and type II. This subfamily represents the atypical type III dockerins and related domains.
cd14252	Dockerin_like	3.91e-05	166	217	1	52	Dockerin repeat domains and domains resembling dockerin repeats. Dockerins are modules in the cellulosome complex that often anchor catalytic subunits by binding to cohesin domains of scaffolding proteins. Three types of dockerins and their corresponding cohesin have been described in the literature. This alignment models two consecutive dockerin repeats, the functional unit.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBZ48778.1	1.86e-72	438	888	196	606
BAK28435.1	1.86e-72	438	888	196	606
QKI00169.1	1.86e-72	438	888	196	606
QWX86240.1	1.86e-72	438	888	196	606
AQP42752.1	9.38e-72	438	888	196	606

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RU4_A	6.02e-09	572	814	160	296	ChainA, Pectate lyase [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0C1A7	3.58e-08	572	814	185	321	Pectate lyase L OS=Dickeya dadantii (strain 3937) OX=198628 GN=pelL PE=1 SV=1
P0C1A6	1.45e-07	504	814	145	321	Pectate lyase L OS=Dickeya chrysanthemi OX=556 GN=pelL PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000247	0.999076	0.000190	0.000172	0.000149	0.000143

TMHMM  Annotations     

start	end
7	29