CAZyme Information: MGYG000002621_01896

Basic Information

• Species: Bacteroides ndongoniae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides ndongoniae
• CAZyme ID: MGYG000002621_01896
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
747	MGYG000002621_20|CGC1	85054.19	7.2861

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002621	3633256	MAG	China	Asia

• Gene Location: Start: 55901; End: 58144 Strand: -

Full Sequence      

MKQLLYTLILLCIGTYTAVAQVISPDCPPDKIEPGSWYCFRNTVNLKRQPRNVSLHIAAD
SKYWLWVNGELQVREGGLKRGPNPNDTYCDTIGSLPALKKGQNTIALLVWYFGKDGFSHR
NSPTPGMTFALNVDGKDIRLRKPWKSIAHPAFYQPEGEQPNYRLPESNIGFDAGKDIDFT
RPDFDDSQWPDARLTDLAAAGWNKLQPRPIPQWKDYGLKPYERTERINDTILHAYLPYNA
QITPYIRLRADKGRKVRIRTDNYTGGSANNVFAEYTTRQGEQDFECLGWMNGHYVVYQVP
KDAEVLDLMYRETGYDTYFAGSFHCDDPALNRLWEKSQRTLYITMRDTYMDCPDRERAQW
WGDVVNELGEAFYALDEKAHLLTRKGIRELMGWQRADSTIFAPVPAGNYDSELPMQMLAS
VGYYGFWTYYMGTADSATIGYVYPNVKKYIHVWKTDAQGLAIPRKGGWTWGDWGENKDME
LLFSQWYIIALQGYERMARLIGDTTEADWAQTTADRARTAFHQKYWNGSYYVSPSHQGLP
DDRPQALAVVSGTLPDTLYPALRPFFGQQYHASPYMEKYVLQALCLMGYHQDALNRMKLR
YRAMTDSPLTTLWEGWGIGSEGFGGGTYNHAWSGGPLTVMSQYIAGIEPTAPAFRRFRVS
PHPAHLNQIRAVVPLSGKREIRLSLDKDSRRCDIVLEVPQGTEACFCLPDGYTGMSVNST
VCQSAEKVLTPGVWNIRLTQAGDYASK

Enzyme Prediction     

No EC number prediction in MGYG000002621_01896.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	243	704	2.7e-80	0.9563492063492064
CBM67	30	195	2.1e-26	0.8920454545454546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.63e-27	320	644	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam04685	DUF608	5.69e-06	487	531	172	216	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.
pfam17390	Bac_rhamnosid_C	1.75e-04	646	711	1	66	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17167	Glyco_hydro_36	0.009	440	553	160	286	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDH54696.1	0.0	5	736	7	736
QNL36670.1	0.0	1	736	4	736
QLG44645.1	4.05e-253	20	704	26	713
QUT89760.1	4.04e-249	34	732	41	728
QUT48047.1	4.80e-249	33	711	36	717

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	8.44e-11	35	220	21	205	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000204	0.999156	0.000159	0.000174	0.000152	0.000147

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002621_01896.