CAZyme Information: MGYG000002650_02372

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA11452
• CAZyme ID: MGYG000002650_02372
• CAZy Family: GH2
• CAZyme Description: Evolved beta-galactosidase subunit alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1026		116223.3	5.1217

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002650	3040804	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 387; End: 3467 Strand: -

Full Sequence      

MNDWENQNLTSINKEPYRAWTIAFDNQEDALNGEISLSPFFKLLNGAWKFSYYNSPGEIP
EGFFQEDFDCDEWDDIMVPSNWQMKGYGHPHYTNSIFPFPLNPPHVPSENPTGCYIREFE
ITDAWADRRILLKFDGVDSFYYVWINGQLAGMSKGSRNASEFDITDIAQIGVNRIAVQVL
QWSDGTYLEDQDMWWLSGIFRDVSISAVPLVDIYDIFVKAKLDAAYKNGLLEIEAVIRND
ESVEASGITVEAELFDSCGNPVWKKPVSSAAVRIDEGKQMKVKLSAEVKNVSPWTAETPV
LYMLVLTLKNKSGAIEYKSQKIGFRTVEIKKGSLLINGVPVMFRGVNRHEFNTDLGRALT
LDAMMEDLLLLKRHNVNAIRTSHYPDAPLFYDLCDKLGFYVMSEADLESHGFGYEEGKNP
TMWKDWEKACVDRMQAMVESYKNHASVVIWSLGNESGYGINHVKMAEYTRSRDLSRPIHY
ERDTEAKITDIVSRMYASPADCIETAEKYCKGKKPFLLCEYAHAMGNGPGGLEDYWQTFF
SHKEMQGGFIWEFCDHGIRTRDEHGHEYFAYGGDFGDEPNDGNFITDGLVFSDKTPSPGM
TEAKKVYSPVRFSAKDLKKGIVTVVNHYDFVTLEHLNVTWSVSENGIPVQSGSLAPLKIN
ARNAANVMVPYVLPKKPKPGAEYFLNLTFTLGQDTSWARSGHEVAWAQFALPVKAAARRN
PKKTAVPVEMDEDSQSVYAFANEALFAVSKTTGLITSWTLDEVPLMERGPRFNLFRAPTD
NDNGRANGCFKDWFAARFHQLQHTVESVDADSDSNTVRVITRVAPPALKSGIRCEYLYTF
QPDGGFTLQLNGKPEGELPCFPRLGFQMFLPEEMDYAQWFGLGPGESYVDTKEAQRVDLF
KADIDVLYTPYVKPQEDGNRSEVRRAAFYDLHMAGFAVRGINTLFNFSMHRFTPEAAWKA
RHPHKIEYLDNICLNLDWKQCGIGSSSCGAPLDERYKLPAEPFTFALRFHPFRPGELNDC
SFFSMV

Enzyme Prediction     

No EC number prediction in MGYG000002650_02372.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	35	897	3.5e-229	0.9680851063829787

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	0.0	36	898	7	807	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK09525	lacZ	0.0	2	984	15	998	beta-galactosidase.
PRK10340	ebgA	0.0	1	1022	1	1010	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	3.90e-116	327	612	1	302	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
smart01038	Bgal_small_N	7.93e-82	746	1009	7	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQT02343.1	0.0	3	1018	7	1041
QFK71622.1	0.0	3	1018	7	1041
BBH86227.1	0.0	3	1012	11	1010
QCJ44442.1	7.19e-317	2	1018	7	1035
ASJ56460.1	1.90e-311	3	1018	6	1023

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	7.94e-235	3	1008	3	978	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	8.18e-235	3	1008	4	979	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
1YQ2_A	9.54e-191	44	1011	36	1023	ChainA, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_B Chain B, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_C Chain C, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_D Chain D, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_E Chain E, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_F Chain F, beta-galactosidase [Arthrobacter sp. C2-2]
3BGA_A	3.00e-188	3	1016	9	1005	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
6ETZ_A	9.19e-184	44	1007	39	983	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB [Arthrobacter sp. 32cB],6H1P_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB - data collected at room temperature [Arthrobacter sp. 32cB]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P06864	6.18e-235	1	1016	1	1004	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
Q56307	4.48e-234	3	1008	4	979	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	5.54e-221	3	984	19	1004	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
A1SWB8	1.10e-203	3	991	12	1013	Beta-galactosidase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=lacZ PE=3 SV=1
P81650	1.24e-203	3	1007	12	1031	Beta-galactosidase OS=Pseudoalteromonas haloplanktis OX=228 GN=lacZ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002650_02372.