CAZyme Information: MGYG000002659_01986

Basic Information

• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium_A
• CAZyme ID: MGYG000002659_01986
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
208		22490.04	4.3919

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002659	2094336	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 15; End: 641 Strand: +

Full Sequence      

MRLASGRILAGASTEHGIWKAFADISDDDGASWHKSAVVQIDGLQYQAGEKTAESNIAVS
QQSFYGRGVIQPSLWQSADGSVHMLLRSSEGFVYRSDSADNGETWCSAYALSLPNNNSGL
DLVRTAGGVLYLVCNPVAANWGQRSPLSLFQSTDEGASWRRLLDLETEPAEFSYPAIIAL
GEDIVITYTYKRCSIACVSLSADELVNL

Enzyme Prediction     

No EC number prediction in MGYG000002659_01986.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	3	188	3.9e-16	0.47953216374269003

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13088	BNR_2	9.94e-48	3	185	119	278	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4692	COG4692	7.98e-35	19	207	176	381	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
cd15482	Sialidase_non-viral	8.47e-27	1	192	151	326	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
smart00602	VPS10	2.27e-04	84	162	3	70	VPS10 domain.
cd15482	Sialidase_non-viral	0.003	3	178	30	205	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV77693.1	3.49e-137	1	208	131	338
ALS21221.1	9.24e-74	3	196	138	331
AUS95056.1	1.51e-71	3	196	137	327
AZS14954.1	4.61e-63	3	196	138	330
AKL13497.1	2.91e-57	19	192	156	336

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002659_01986.