CAZyme Information: MGYG000002663_01341

Basic Information

• Species: Prevotella sp900772835
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900772835
• CAZyme ID: MGYG000002663_01341
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402	MGYG000002663_56|CGC1	45724.07	6.8276

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002663	2098573	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 13092; End: 14300 Strand: -

Full Sequence      

MRFRRGNTHVWYREDSFGGNPVGNIMIDHCSCEWGLDENISFYRHMFDLHDGKPKRKVPT
VNVTIQNTISAKALDTWNHAFGSTIGGENSSFMRNLWADNTGRNPSIGWGGVFNFVNNII
YNWVHRTADGGEYSTMSNFINNYYKPGPLTPKNSPIGYRIVKSESRSNKLFDYPQYGRIY
AVGNIVEGNERVTKNNWDGGIQIADKDLPNGIPDDVKALMHSNEPFAMPHMTIIPSDQTF
DKVLSNVGATMPCRDIVDQRIVEEVRTGQAYYVKKLPKKNPYGDMWGLSDKSKNEEGFFK
YRRLDKDSYKHGIITSIEQMGGFPKYKKYTAWKDSDGDGMPDEWEIANGLNPNDPSDANL
DCNGDGYTNIEKYINGIDTKKKVDWTDLRNNHDTLDGKTSLM

Enzyme Prediction     

No EC number prediction in MGYG000002663_01341.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	1	144	5.7e-39	0.7377049180327869

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18884	TSP3_bac	3.53e-04	334	355	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT66944.1	4.38e-271	1	402	181	581
BCS84828.1	7.29e-241	1	402	180	578
QIM10099.1	6.83e-236	1	398	190	584
QUT92137.1	2.47e-207	1	402	181	575
ALJ62113.1	2.47e-207	1	402	181	575

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8NQQ7	7.10e-19	14	377	130	413	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
B0XMA2	1.76e-18	19	377	135	414	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
Q4WL88	3.20e-18	19	377	135	414	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
Q0CLG7	4.28e-18	23	377	138	413	Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyC PE=3 SV=1
A1DPF0	5.81e-18	19	377	135	414	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002663_01341.