CAZyme Information: MGYG000002721_00279

Basic Information

• Species: CAG-873 sp009775195
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp009775195
• CAZyme ID: MGYG000002721_00279
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
732		82686.64	5.5686

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002721	3174810	MAG	Canada	North America

• Gene Location: Start: 122515; End: 124713 Strand: -

Full Sequence      

MNNFLCKFALLLCVALSFALDARSSDRKAVWIAPETAQGQPNTWLIFRKDIKLAQVPATL
MADIAADTKYWMWLNGEMAVFEGGLKRGPEPNATYFDRVDIAPYLKPGDNTIAILVWHFG
KNGFAHVNSGSAGLFFEAVSPEVAILSDNTWQSDVYDAYGDTEAPYPNFRLAESNIRFDA
RKERDGWNMPGYKGKLPGAFYIADASNSPFGKLVERPIPMWKDYGLKSYESTRRSGDTIV
CRLPYNCQMTPYLKVSAPAGKTIRMQTDNYMGGSTYNMRAEYVTRDGVQEYESLGWLNGH
EMLYIVPEGVEVLDLKFRETGYDTELAGTFTCDDPFLEELYKRSARTLYITMRDNYMDCP
DRERAQWWGDEVNELGETFYALTPSAHKLAVKGIYELMNWQRDDGVIYSPVPSGNWHREL
PLQMLASVGHYGFYTQYFYSGDSTFVADIYEPLHRYLHEVWQPGDHGLMTNRAGDWTWGD
WGENIDLDILTNCWYYLALKGEREFARMLGKDDDIAMIDSKMKTIKDNFDSTYWTGTEYR
SPGYTNPTDDRSQAMAVVSGLAPESRYPDIVKLLDTEYNASPYMEKYVLEALFIMGQPQR
AIDRMHKRYAKMLGYKDYTTLFEGWGIGAEGFGGGTLNHAWSGGPLTLMCQKICGVEPTS
PGFKTFKISPQLGKLKRASTSIETNYGTISVSLVKKGSRIAADITVPQGTTAQITVKGKP
RTLAPGTHHVTI

Enzyme Prediction     

No EC number prediction in MGYG000002721_00279.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	247	715	2.3e-88	0.9642857142857143
CBM67	29	193	2.3e-29	0.8920454545454546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.49e-24	327	649	3	336	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.22e-10	655	730	1	77	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.91e-04	93	192	44	142	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48047.1	0.0	1	728	1	727
ABR43077.1	0.0	28	730	32	737
QRO16732.1	0.0	28	730	32	737
QUT54419.1	0.0	28	730	33	738
QCY56550.1	0.0	28	730	32	737

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	1.77e-12	29	219	8	196	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000287	0.999031	0.000218	0.000158	0.000150	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002721_00279.