CAZyme Information: MGYG000002737_01837

Basic Information

• Species: Prevotella sp900553465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900553465
• CAZyme ID: MGYG000002737_01837
• CAZy Family: GH116
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
618		69888.4	5.7221

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002737	2443712	MAG	Netherlands	Europe

• Gene Location: Start: 87; End: 1943 Strand: +

Full Sequence      

MDIRKIVAVVAALFVWCTDVTAQQPAEVDGYPLSNFALTVNASQDGGFFGQIMRNPGRIG
EWLQDKGGVEFFVEKDGRRHSFSEFRKKTVDRAFPFVRNTYHGSPLTKTSFAVTAFCPLA
VNDARTSALPLLMVEMECTNTRRTAETFDIVAVPAEGMAQGMSAVRGNGYSGAGDGKCVE
LTADVPTSWDGGALRMHLNLGAKEKRTVRILLAFHDNEWVSALDYASPDKLTAYGRAVWP
VLKDKTEGFSRAIPVTGDDELDSFLRWYMVSGVSLTKWTRNDEVVTMGYRELNQRDSYWT
SWLHLVMFKDLERRMIEESIAWQQPSGKIPTTILPLIERNDDLDINAFFILRVARFWQMY
HEQQNLQKYWPALKKAMEWLILRDKEHVGLPMQVSFWGDWKDVGGVEGRKYSPFSCLVYM
AALKKMEFMAEACGDSKAACEYAGAYDRAFRRVNMDVKDGGLWNGEYYCQIWRDGSVNDR
LLQDQTIGILFGVVPNDRAAKIFGALNERSLTPYGVAETFPYYDESFGYPPATYHNGAVW
PWVSFMDCWARVRTGRRDEAVELVKRVGRADLVDSGDWSPNEHINSLTGENLGFHIQGWN
AGLFGMVYFGLVNTGVID

Enzyme Prediction     

No EC number prediction in MGYG000002737_01837.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH116	327	565	2.1e-19	0.6556473829201102

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4354	COG4354	5.99e-15	344	590	442	697	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].
pfam04685	DUF608	1.46e-13	344	567	99	324	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.
COG3408	GDB1	1.31e-08	295	566	287	564	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam17167	Glyco_hydro_36	2.29e-05	389	613	181	419	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.
pfam17389	Bac_rhamnosid6H	6.50e-05	323	505	76	249	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUR48358.1	2.70e-303	22	617	23	619
QCY58135.1	3.84e-303	22	617	23	619
QJE29784.1	3.84e-303	22	617	23	619
QUT52127.1	5.44e-303	22	617	23	619
ANH81218.1	6.16e-272	15	617	14	613

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000225	0.999156	0.000170	0.000141	0.000137	0.000129

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002737_01837.