CAZyme Information: MGYG000002831_00589

Basic Information

• Species: CAG-349 sp003539515
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-917; CAG-349; CAG-349 sp003539515
• CAZyme ID: MGYG000002831_00589
• CAZy Family: GH20
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
532		60897.57	7.5488

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002831	1529515	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 27479; End: 29077 Strand: +

Full Sequence      

MRIIPCPKEFTKKDGSFLFDAETGFSCDYENVGNSISSFLKTCGIGWRTGDDIKFTSDGS
DSSSEAYTLVVGEDGVKVSAKSERGLFYGAQTLKQLILSSFDEKTKTAEIPCCEINDEPR
FSYRGYMFDTVRHFFPVEVVKKYIEAISLLKLNVFHWHLSDDQGWRVQIDKYPRLTEHGS
MRRETCGDKKPHGGFYTKEQIKDVVEFAKERFITVIPEFDIPGHTRAAVSSYPELGCSKK
PVEVSTKFGIHSEILCAGREESYDFVKGVLTEFAEMFPSKYIHIGGDEAVKHEWYKCKDC
QKKMKELGLRNEEELQAYFTEKVVEYLKSLNKTAICWNESANSGKLESSVILQFWSDGKD
NENVIREVKNGRKIIVSKFNPYYLDYPYPMHSLKAAYEFEPVFHGIEGYEQNVLGVESTL
WTEWIDNTDLLAFRVFPRLTAVAESAWCVKSKKDYLAFENSLKNVNKLIENTTGIKAAPL
KDCNVKNPLKRAAIMMKFGMNLIDFEMIARSNRAAKEMKKMRSVRKKENNGK

Enzyme Prediction     

No EC number prediction in MGYG000002831_00589.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	117	447	3.6e-111	0.9643916913946587

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06563	GH20_chitobiase-like	1.34e-166	121	462	1	357	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	4.23e-138	121	447	1	343	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
cd06568	GH20_SpHex_like	2.84e-105	121	462	1	329	A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex). SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.
COG3525	Chb	6.73e-99	64	463	205	629	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd06570	GH20_chitobiase-like_1	1.06e-96	121	454	1	303	A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This subgroup lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUH29206.1	2.73e-140	1	470	3	482
AFH50886.1	2.69e-114	1	463	20	486
QGY47351.1	9.75e-112	3	470	25	518
ALO49927.1	2.43e-111	3	462	14	507
CEA15906.1	8.63e-111	3	470	33	529

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q63_A	1.39e-93	65	470	106	527	BT0459[Bacteroides thetaiotaomicron],6Q63_B BT0459 [Bacteroides thetaiotaomicron],6Q63_C BT0459 [Bacteroides thetaiotaomicron]
7DUP_A	4.90e-90	3	463	6	507	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_A Chain A, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]
3RCN_A	6.22e-90	2	480	9	516	CrystalStructure of Beta-N-Acetylhexosaminidase from Arthrobacter aurescens [Paenarthrobacter aurescens TC1]
7DVB_A	2.69e-89	3	463	6	507	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_C Chain C, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_D Chain D, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]
6EZR_A	1.85e-88	3	492	142	644	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZR_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZS_A Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6EZS_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6K35_A Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi],6K35_B Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49008	3.73e-95	1	464	35	520	Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=nahA PE=3 SV=2
B2UQG6	2.45e-82	4	455	33	511	Beta-hexosaminidase Amuc_0868 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0868 PE=1 SV=1
B2UP57	5.55e-74	64	469	57	469	Beta-hexosaminidase Amuc_2018 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2018 PE=1 SV=1
P96155	2.67e-69	1	445	139	603	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1
Q7WUL4	6.15e-58	57	455	74	456	Beta-N-acetylhexosaminidase OS=Cellulomonas fimi OX=1708 GN=hex20 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002831_00589.