CAZyme Information: MGYG000002878_00613

Basic Information

• Species: RC9 sp900546395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900546395
• CAZyme ID: MGYG000002878_00613
• CAZy Family: GH57
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293		33688.88	4.8933

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002878	2590775	MAG	United States	North America

• Gene Location: Start: 10864; End: 11745 Strand: +

Full Sequence      

MEPKTFRNTELIYSDAIGSMVYDMGFKTMLTEGAKHVLGWKSPNYLYSGAQAKDLRLLLK
NSSLSDDIAFRFSDRTWQDWPLTGEKYLSWIKSSAHNDEIVNLFMDYETFGEHQKAQSGI
FDFMRYFPEVVLKDGEFEFVTPAQASKKHAPVGELDVPDAISWADEERDVTAWLGNELQN
DSFSKLYELTEKLSLLNDPVLWSDFGHLQESDHFYYMCTKFFSDGAVHKYFNPYDTPYEA
FINYMNVLSDFIIRVDEAMSVNDANFAVSKTEKAEKKPAVRKTASKKTASSKK

Enzyme Prediction     

No EC number prediction in MGYG000002878_00613.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH57	2	186	2.1e-33	0.4699738903394256

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10795	GH57N_MJA1_like	1.06e-98	2	176	136	306	N-terminal catalytic domain of a thermoactive alpha-amylase from Methanococcus jannaschii and similar proteins; glycoside hydrolase family 57 (GH57). The subfamily is represented by a thermostable alpha-amylase (MJA1, EC 3.2.1.1) encoded from the hyperthermophilic archaeon Methanococcus jannaschii locus, M J1611. MJA1 has a broad pH optimum 5.0-8.0. It exhibits extremely thermophilic alpha-amylase activity that catalyzes the hydrolysis of large sugar polymers with alpha-l,6 and alpha-l,4 linkages, and yields products including glucose polymers of 1-7 units. MJ1611 also encodes another alpha-amylase with catalytic features distinct from MJA1, which belongs to glycoside hydrolase family 13 (GH-13), and is not included here. This subfamily also includes many uncharacterized proteins found in bacteria and archaea.
COG1449	COG1449	9.53e-60	2	262	236	509	Alpha-amylase/alpha-mannosidase, GH57 family [Carbohydrate transport and metabolism].
pfam03065	Glyco_hydro_57	5.28e-40	2	158	142	293	Glycosyl hydrolase family 57. This family includes alpha-amylase (EC:3.2.1.1), 4--glucanotransferase (EC:2.4.1.-) and amylopullulanase enzymes.
cd01022	GH57N_like	3.99e-18	1	175	131	313	N-terminal catalytic domain of heat stable retaining glycoside hydrolase family 57. Glycoside hydrolase family 57(GH57) is a chiefly prokaryotic family with the majority of thermostable enzymes coming from extremophiles (many of these are archaeal hyperthermophiles), which exhibit the enzyme specificities of alpha-amylase (EC 3.2.1.1), 4-alpha-glucanotransferase (EC 2.4.1.25), amylopullulanase (EC 3.2.1.1/41), and alpha-galactosidase (EC 3.2.1.22). This family also includes many hypothetical proteins with uncharacterized activity and specificity. GH57s cleave alpha-glycosidic bonds by employing a retaining mechanism, which involves a glycosyl-enzyme intermediate, allowing transglycosylation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACM90986.1	2.81e-143	3	282	141	423
QJT73070.1	5.29e-139	3	260	140	395
AGY53209.1	3.30e-125	3	256	140	393
QKG79280.1	7.34e-124	2	259	138	395
SNV25947.1	2.98e-120	1	257	139	393

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59006	6.55e-72	4	263	139	404	Putative alpha-amylase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1611 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002878_00613.