CAZyme Information: MGYG000002885_02999

Basic Information

• Species: Pseudomonas_E juntendi
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E juntendi
• CAZyme ID: MGYG000002885_02999
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
251		27721.96	10.4477

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002885	3148284	MAG	United States	North America

• Gene Location: Start: 5; End: 760 Strand: +

Full Sequence      

MFEKGLSAAYAHNSYGQGLMPDTFIDFKKQRFRWAYGAIQIIKHHAGALLRGTGSQLTRG
QRYHFLAGWLPWIADGMNIFFTIGALLWSAAMIIVPHRVDPPLMIFAIPPLALFFFKVGK
ILFLYRRAVGVNMKDAFAAALAGLALSHTIAKAVLYGFFTSSMPFIRTPKHADSHGLLVA
IAEAREELFIMLLLWGAALGIYLVQGLPSSDMRFWMAMLLVQSLPYVAALVMALLSSLPK
PAHKAAEAQQA

Enzyme Prediction     

EC	2.4.1.-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06435	CESA_NdvC_like	6.28e-18	1	46	191	236	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
COG1215	BcsA	3.34e-08	1	133	247	362	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06421	CESA_CelA_like	4.02e-06	3	42	195	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
PRK11204	PRK11204	0.008	19	51	260	292	N-glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOH68702.1	4.85e-168	1	251	613	863
QDR67129.1	4.85e-168	1	251	613	863
QEQ86882.1	4.85e-168	1	251	613	863
QKL00875.1	1.37e-167	1	251	613	863
QHB26432.1	6.10e-164	1	251	160	410

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.996403	0.003186	0.000308	0.000018	0.000007	0.000071

TMHMM  Annotations     

start	end
66	88
103	125
137	159
188	207
214	236