CAZyme Information: MGYG000002912_01522

Basic Information

• Species: UBA10677 sp900543755
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UBA10677; UBA10677 sp900543755
• CAZyme ID: MGYG000002912_01522
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344		38956.75	6.2535

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002912	1879491	MAG	United States	North America

• Gene Location: Start: 1012; End: 2046 Strand: +

Full Sequence      

MIEKFTVSRDDNVYQAWPDVTINNDGCLVCVFTECAHHADRSGSRLMTTVSRDGGETWSE
KRPLTEKSDSSFFWNNARISLLNDGNLYIVCDKATRSENENSKIYLFISKDGGETWSEAK
ELPCFGIVPSKLTELKYGDYAGRRIIMAHSRDENDIYTVRSWYSDDRGKSWSGPVTVVSR
KEYKLCEAAPIELKNGVLTVLLRENSSKGLDAFKTFSYDGGDSFNGLYTAPLPGCHRPVA
DYVDDETVLITYRFMQGGKGWLGHWTQNVFAAFMSDKDLSEKLRENQSSRIMPLDYDRSA
VSDLGYTGFTKLKDGRVYVVNYIVDDAPKAHIRGYRFGKKDVIL

Enzyme Prediction     

No EC number prediction in MGYG000002912_01522.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	18	306	9.6e-23	0.8508771929824561

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	2.71e-20	5	320	4	321	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
cd15482	Sialidase_non-viral	1.73e-17	20	252	82	322	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	1.27e-08	18	122	165	257	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13088	BNR_2	1.34e-07	42	233	9	207	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13088	BNR_2	1.54e-07	25	174	61	201	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYB46154.1	6.97e-122	2	344	3	342
ANY72719.1	8.29e-121	2	344	3	342
AHF91127.1	4.45e-104	1	344	1	357
AVM44758.1	1.20e-94	1	344	1	345
AHF89372.1	6.28e-78	1	344	1	353

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C5DU19	1.82e-06	97	231	463	589	Vacuolar protein sorting/targeting protein 10 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) OX=559307 GN=VPS10 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002912_01522.