CAZyme Information: MGYG000002937_01136

Basic Information

• Species: Sporolactobacillus sp900543345
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_G; Sporolactobacillaceae; Sporolactobacillus; Sporolactobacillus sp900543345
• CAZyme ID: MGYG000002937_01136
• CAZy Family: GT2
• CAZyme Description: Acetyl-coenzyme A synthetase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573	MGYG000002937_71|CGC1	64365.39	5.5034

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002937	2947302	MAG	Russia	Europe

• Gene Location: Start: 1522; End: 3243 Strand: +

Full Sequence      

MLNSFVLPAEHGTHNLEDLEAMSKVFDWRQAEKLVDWSRTGKVNAAYELIDRHAEGEKAD
KIALYYSDPQRDETYTFAEMKRLTNRAANVLRHEAEVGKGDRVFLFMPRMPELYFLLLGA
IKAGAIVGPLFEAFMKDAVRDRLADSQASVLCTTPELIGRVPLDDLPHLRHIVLVGESAG
EAGRFIDYRQAIGRSSDDFEIEWLDPEDGMILHYTSGSTGKPKGVLHVHQAVVQHAQMGK
WILDLQDDDQYWCTADPGWVTGTSCGIFAPWVNGCSNIIRGGRFSPEDWYQTIEKYGVTV
WYSAPTAFRMLMAAGDDLPEHYDLSSLRHILSVGEPLNPEVIRWAWRAFGRRIHDTWWMT
ETGGPTICNIPSMPIKAGSMGKPVPGITAAILDDQGNELPPNTMGNLAIRRGWPSMMRAI
WNNKEKYNSYFTANGWYVSGDSAYMDEDGYFWFQGRIDDVIMTSGERIGPFEVESKLVEH
PAVSEAGVIGIPDPIRGEIIKAFIALREGFEATDRLKKEIHLFVKNGLAAHAAPRMIEFI
GKLPKTRSGKIMRRVLKAWELGLPTGDLSTMED

Enzyme Prediction     

No EC number prediction in MGYG000002937_01136.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00174	PRK00174	0.0	24	573	49	622	acetyl-CoA synthetase; Provisional
COG0365	Acs	0.0	36	570	1	528	Acyl-coenzyme A synthetase/AMP-(fatty) acid ligase [Lipid transport and metabolism].
cd05966	ACS	0.0	23	573	32	608	Acetyl-CoA synthetase (also known as acetate-CoA ligase and acetyl-activating enzyme). Acetyl-CoA synthetase (ACS, EC 6.2.1.1, acetate#CoA ligase or acetate:CoA ligase (AMP-forming)) catalyzes the formation of acetyl-CoA from acetate, CoA, and ATP. Synthesis of acetyl-CoA is carried out in a two-step reaction. In the first step, the enzyme catalyzes the synthesis of acetyl-AMP intermediate from acetate and ATP. In the second step, acetyl-AMP reacts with CoA to produce acetyl-CoA. This enzyme is widely present in all living organisms. The activity of this enzyme is crucial for maintaining the required levels of acetyl-CoA, a key intermediate in many important biosynthetic and catabolic processes. Acetyl-CoA is used in the biosynthesis of glucose, fatty acids, and cholesterol. It can also be used in the production of energy in the citric acid cycle. Eukaryotes typically have two isoforms of acetyl-CoA synthetase, a cytosolic form involved in biosynthetic processes and a mitochondrial form primarily involved in energy generation.
PRK04319	PRK04319	0.0	6	573	5	570	acetyl-CoA synthetase; Provisional
cd05969	MACS_like_4	0.0	75	561	1	442	Uncharacterized subfamily of Acetyl-CoA synthetase like family (ACS). This family is most similar to acetyl-CoA synthetase. Acetyl-CoA synthetase (ACS) catalyzes the formation of acetyl-CoA from acetate, CoA, and ATP. Synthesis of acetyl-CoA is carried out in a two-step reaction. In the first step, the enzyme catalyzes the synthesis of acetyl-AMP intermediate from acetate and ATP. In the second step, acetyl-AMP reacts with CoA to produce acetyl-CoA. This enzyme is only present in bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE6201330.1	1.61e-105	20	573	613	1202
CAE6201338.1	1.86e-105	20	573	624	1213
AFZ04852.1	2.14e-25	34	558	570	1076
BAY30132.1	6.05e-24	34	558	2694	3209
BAZ75991.1	2.27e-21	1	558	2665	3207

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P2F_A	9.16e-117	35	573	67	634	ChainA, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium],2P2F_B Chain B, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium]
5JRH_A	1.14e-116	35	573	67	634	Crystalstructure of Salmonella enterica acetyl-CoA synthetase (Acs) in complex with cAMP and Coenzyme A [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5JRH_B Crystal structure of Salmonella enterica acetyl-CoA synthetase (Acs) in complex with cAMP and Coenzyme A [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
2P2Q_A	1.29e-116	35	573	67	634	ChainA, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium],2P2Q_B Chain B, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium]
2P2M_A	1.29e-116	35	573	67	634	ChainA, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium],2P2M_B Chain B, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium]
2P20_A	2.56e-116	35	573	67	634	ChainA, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium],2P20_B Chain B, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39062	5.16e-309	2	573	1	572	Acetyl-coenzyme A synthetase OS=Bacillus subtilis (strain 168) OX=224308 GN=acsA PE=1 SV=1
A0B8F1	1.38e-137	23	571	71	646	Acetyl-coenzyme A synthetase OS=Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) OX=349307 GN=acsA PE=1 SV=1
A4WJG1	1.07e-136	10	573	38	649	Acetyl-coenzyme A synthetase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321 / PZ6) OX=340102 GN=acsA PE=3 SV=1
O93730	1.51e-136	15	573	43	649	Acetyl-coenzyme A synthetase OS=Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2) OX=178306 GN=acsA PE=3 SV=2
P27095	2.80e-134	14	571	60	659	Acetyl-coenzyme A synthetase OS=Methanothrix soehngenii OX=2223 GN=acsA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002937_01136.