CAZyme Information: MGYG000002937_01281

Basic Information

• Species: Sporolactobacillus sp900543345
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_G; Sporolactobacillaceae; Sporolactobacillus; Sporolactobacillus sp900543345
• CAZyme ID: MGYG000002937_01281
• CAZy Family: GT2
• CAZyme Description: Spore coat polysaccharide biosynthesis protein SpsA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
261	MGYG000002937_85|CGC1	30767.26	9.8045

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002937	2947302	MAG	Russia	Europe

• Gene Location: Start: 7785; End: 8570 Strand: +

Full Sequence      

MIRVSVIMTSYNKPEYVARSLESILRQSEKNFELFLMDDASNQDTMAAVAPYLSDPRVRF
FRSGVRSITERTVKTRYAVLINRALLQIKGKYVTYATDDNVYHPQRLEKMADYLEAHPSI
SIVYSGSETRYLDERQHVVRTLRRPATRVLHLAPCAVDHCSVMHRRLLLPQLKKRFGSYW
DEDPCYYRIGDARFFWRLNHLAPFYPLNETLDTNYITTRSLHHQLFAPTKNEFVSRLPQQ
HTCKELRESLAQFFKEKGRPQ

Enzyme Prediction     

No EC number prediction in MGYG000002937_01281.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	5	168	8.6e-23	0.9705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	6.47e-25	5	168	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	8.88e-24	6	125	1	113	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd06433	GT_2_WfgS_like	1.81e-16	5	211	1	190	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd04184	GT2_RfbC_Mx_like	1.15e-15	3	125	2	119	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
COG0463	WcaA	1.35e-15	1	208	2	201	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AME07021.1	2.95e-112	1	255	1	255
AUJ75601.1	2.95e-112	1	255	1	255
APB84009.1	5.94e-112	1	255	1	255
AWM84795.1	5.94e-112	1	255	1	255
AKF32493.1	1.20e-111	1	255	1	255

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1H7L_A	1.25e-107	3	250	2	249	dTDP-MAGNESIUMCOMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1H7Q_A dTDP-MANGANESE COMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1QG8_A Native (Magnesium-Containing) Spsa From Bacillus Subtilis [Bacillus subtilis],1QGQ_A Udp-manganese Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis],1QGS_A Udp-Magnesium Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis]
5HEA_A	4.79e-06	4	110	7	105	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39621	3.52e-107	1	250	1	250	Spore coat polysaccharide biosynthesis protein SpsA OS=Bacillus subtilis (strain 168) OX=224308 GN=spsA PE=1 SV=1
P42092	3.06e-58	3	223	4	223	Protein CgeD OS=Bacillus subtilis (strain 168) OX=224308 GN=cgeD PE=4 SV=1
P71054	8.27e-14	3	126	6	123	Putative glycosyltransferase EpsE OS=Bacillus subtilis (strain 168) OX=224308 GN=epsE PE=2 SV=2
Q4UM29	1.09e-08	3	142	294	421	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1
P77414	4.74e-08	4	107	7	103	Putative colanic acid biosynthesis glycosyl transferase WcaA OS=Escherichia coli (strain K12) OX=83333 GN=wcaA PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002937_01281.