CAZyme Information: MGYG000002964_01437

Basic Information

• Species: Oscillibacter ruminantium
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Oscillibacter; Oscillibacter ruminantium
• CAZyme ID: MGYG000002964_01437
• CAZy Family: GH18
• CAZyme Description: Spore germination protein YaaH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
223		25055.44	4.6071

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002964	2326356	MAG	United States	North America

• Gene Location: Start: 14; End: 685 Strand: +

Full Sequence      

MRQQGFAGLDVDFEFLPAYLATPYAEFLARLRRLFGAQGYFVWAALAPKTSAAQRGLLYE
AHDYAAIGSAVDAVLLMTYEWGYTYGPPGPVSPLPQVREVLDYAITEIPAAKIFLGLSNY
GYDWPLPFMEGETKAQSISNQRAIELAIEHEVAIQYDETAQAPFFHYADPGGTVHEVWFD
DARSLSARLRLIQEYGFQGAGIWNVMRPFSQLYLAMSSLYNIR

Enzyme Prediction     

No EC number prediction in MGYG000002964_01437.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	2	205	7.4e-35	0.6283783783783784

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	7.60e-90	1	216	99	313	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	2.58e-69	1	221	203	423	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	1.46e-26	3	203	102	288	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
smart00636	Glyco_18	5.72e-24	1	205	103	331	Glyco_18 domain.
pfam00704	Glyco_hydro_18	1.05e-20	1	205	100	304	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCI61058.1	2.20e-126	1	222	202	423
BCK83840.1	4.61e-116	3	222	204	423
QUO39116.1	1.27e-115	1	222	202	423
QBB66106.1	1.66e-92	1	223	202	424
ALP93864.1	2.34e-92	1	223	202	424

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3K_A	1.48e-65	2	222	209	429	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
4S3J_A	3.26e-56	2	211	208	416	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
3CZ8_A	3.28e-49	4	205	110	308	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4WIW_A	4.70e-23	45	203	161	327	ChainA, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]
5JH8_A	1.13e-21	6	203	105	297	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37531	1.06e-70	2	222	205	425	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
P0DPJ9	6.54e-55	2	211	207	415	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	1.82e-54	2	211	207	415	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1
O05495	6.11e-49	4	223	202	418	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
O32258	3.37e-16	2	203	128	326	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002964_01437.