CAZyme Information: MGYG000002994_00625

Basic Information

• Species: Megasphaera sp002319965
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Megasphaera; Megasphaera sp002319965
• CAZyme ID: MGYG000002994_00625
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
513		58409.01	9.1071

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002994	2223689	MAG	United States	North America

• Gene Location: Start: 15909; End: 17450 Strand: +

Full Sequence      

MEMVLSGDYVTPHFDYMPYFEKPIFQYWVTALAMKLFGFKEFTGRVLPALTGFGNVILAY
VLGRTMYNGRTGLMAAVILATSALQLIVASIGVLDMALTFFVDACLVFFYLFERTEEKKY
LLLFYASMGLGMLTKGLIAIAFPVGILFWYALCTRRPRLFLKLFYVPGILLFLAISVPWY
YLVSKANPDFFYFFFIREHFLRFATKMHERFHPWYYFVPVLIAGLMPWTGFLAAFFSKKG
IFRAPGTLRHKQDLILLSLWAGLIYVFYSISDSKLPTYILPCWMPLSILLAASLARCRRE
KSWLGHSFLINSLLCLLFTAAGVVYLMHTDFLSIADFFSHGGLLIASLLIGTIAAAWCWH
KRRSFLTVFIILTVMAYGFGLGAHQIQGQIHDHQTAYNVSQDIKQLNVPDSTPIIMYGYF
IPGLVYYLDRPIATGNFMGELNFGIHHTDRTGMYYGSNELYALWNSDKPAVIVVEKKYLE
EALRVVGTPPARRITDEDYTVLLNGPAALDAAR

Enzyme Prediction     

No EC number prediction in MGYG000002994_00625.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	2	479	1.7e-108	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13279	arnT	7.58e-61	2	326	42	363	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
COG1807	ArnT	3.45e-55	2	467	44	512	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	2.46e-16	22	181	2	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	2.13e-07	2	180	41	231	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4745	COG4745	9.78e-07	14	328	58	403	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALG43014.1	1.45e-316	1	508	46	553
AVO73572.1	2.40e-315	1	508	46	553
CCC73616.1	2.40e-315	1	508	46	553
AVO26253.1	2.29e-313	1	508	46	553
AXB81287.1	2.42e-301	1	506	46	551

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	3.19e-49	2	474	68	542	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4K884	5.40e-44	2	503	74	576	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT2 PE=3 SV=1
C5BDQ8	1.18e-42	2	452	41	494	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
Q3KCB9	3.44e-40	2	449	41	485	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT2 PE=3 SV=1
A6V1N8	4.72e-40	3	321	42	360	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=arnT PE=3 SV=1
A1JPM4	6.91e-40	2	464	43	507	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000011	0.000011	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
42	64
71	93
130	152
159	181
215	237
254	271
276	295
308	327
337	359
364	386
406	428