CAZyme Information: MGYG000003000_00199

Basic Information

• Species: Rothia aeria
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Micrococcaceae; Rothia; Rothia aeria
• CAZyme ID: MGYG000003000_00199
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331		37535.1	5.9109

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003000	1497242	MAG	United States	North America

• Gene Location: Start: 23191; End: 24186 Strand: +

Full Sequence      

MTPTVAIIVRTKNRPQFLTRALANIAEQTYQDYAVYVVNDGGDRAEAERIVTASPVADKT
TLLHTDGIGMEAASNLGVRESESTYVTVHDDDDLWAPKFLKHTVAALDSTGANMCTVRIV
ERFERETDNGFQVLNERIFHEGLPVVGLQFLYRTNRAVPIGVIYRRDLHTRLGGYRDDLA
VVGDWEFNMRAAAEGEIITIDEPLAYWCQRPEATGAAANSVSREAEHRYYDSKVRAEEIR
KDIASGSSAGPYLYQAHLANELDGRILENHNLLRDVLATLGRIETTQREQGEQLKRIEAA
QREQNERLLRVERALSWRERAERITKYFKRG

Enzyme Prediction     

No EC number prediction in MGYG000003000_00199.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	7	132	1.6e-18	0.7470588235294118

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	1.10e-16	7	169	2	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	1.38e-13	7	196	1	151	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG1215	BcsA	1.16e-12	3	206	54	263	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
COG0463	WcaA	7.18e-12	1	297	1	282	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam13641	Glyco_tranf_2_3	9.32e-11	3	219	2	222	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXW92566.1	9.30e-226	1	331	1	331
QQT89968.1	1.32e-225	1	331	1	331
BAV87034.1	1.32e-225	1	331	1	331
VEI22149.1	5.38e-225	1	331	1	331
VEJ30480.1	2.79e-130	5	268	18	281

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39614	3.93e-12	5	194	3	185	Uncharacterized glycosyltransferase YwdF OS=Bacillus subtilis (strain 168) OX=224308 GN=ywdF PE=3 SV=1
Q4UM29	2.36e-07	3	108	14	118	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003000_00199.