CAZyme Information: MGYG000003091_02407

Basic Information

• Species: Parabacteroides sp900547435
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900547435
• CAZyme ID: MGYG000003091_02407
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388		44988.15	9.2268

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003091	3044653	MAG	Spain	Europe

• Gene Location: Start: 2172; End: 3338 Strand: -

Full Sequence      

MKYLFIVQGEGRGHLTQCIALEEMLRRNGHEVVEVLVGKSATRELPAFFQQKIKAPVYRF
ESPNFLPSVANKRNNLLRSVTYNLCKIPTYLKSIRFIKQHIKESRADVVINFYELLTGFC
YAFYYIGIPQICIGHQYLFLHKDFELPEINRAKIGTLNFFSRLTSIGAEQRLALSFHEMP
ADTKHRIRVVPPLLRKEVFALQPKAGNYIHGYMLNSGFAENVMEWHKRRPETPLCFFWDR
KGENTIKQVDETLSFHPLDDKKFLEMMSGCHAYASTAGFESICEAMYLGKPILMVPAHIE
QDCNAYDAARNGAGIVSKDFNLDNLLGFAQNYHPNTAFRPWVNSAAYKILHELEQEVHAT
YLKKSLQSYYYYFLMKKIYLKNLLVGRH

Enzyme Prediction     

No EC number prediction in MGYG000003091_02407.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13528	Glyco_trans_1_3	7.48e-29	1	323	1	309	Glycosyl transferase family 1.
cd03785	GT28_MurG	3.54e-10	2	316	1	303	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG1819	YjiC	5.01e-07	1	316	2	347	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03784	GT1_Gtf-like	8.18e-04	1	316	1	354	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
PRK00726	murG	0.002	1	205	2	174	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AND20562.1	2.47e-172	1	356	1	356
QQY43690.1	3.51e-172	1	356	1	356
QUT58300.1	3.51e-172	1	356	1	356
QEW36986.1	3.51e-172	1	356	1	356
QJR76573.1	4.98e-172	1	356	1	356

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58652	1.90e-06	1	316	1	316	Uncharacterized glycosyltransferase MJ1255 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1255 PE=3 SV=2
B0TY93	4.22e-06	2	326	6	328	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / FSC 153 / O#319-036) OX=484022 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003091_02407.