CAZyme Information: MGYG000003097_03112

Basic Information

• Species: Phocaeicola sp000436795
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp000436795
• CAZyme ID: MGYG000003097_03112
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	MGYG000003097_55|CGC1	42307.53	6.8248

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003097	3921942	MAG	Spain	Europe

• Gene Location: Start: 16460; End: 17575 Strand: -

Full Sequence      

MAYHYQFSVSEDGKEWKVLVSDGEFSNIMHNPLPQTVSLPSVPTARYVKLEATTPDDSAA
VIEMEELGVTVIDDKDDETKVYPHPDETLKLKPGDAHPTQKGWHFYTAHEFLDKYTKKGL
PLGFQEHKTKTMSKAACVNNARCSKVENGVLHMWPVEETDSIDNGFGKNVKFSHAAYRSV
TSGKQTWCKFTENMRIEIRFKRTAAEGFNEALWFMGNKGPWPKNGEIDLLENPKKQINQR
AHFTLHSEHYYAGVVGGKGSVTSSINLGDMSQWNIYWLEWYPDRIVGGVNGKAYFEHKKG
ANGNIDWPWSDLAGFYLIFSTGLSVDPEAWPGAVDSQKWSKQNPPSMYIDWVRVYVNDNY
NRDKAPKVRYY

Enzyme Prediction     

No EC number prediction in MGYG000003097_03112.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	134	355	4e-29	0.8739130434782608

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	1.57e-29	144	355	40	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	1.36e-11	195	355	69	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
COG2273	BglS	2.94e-07	161	366	92	274	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
cd02180	GH16_fungal_KRE6_glucanase	3.11e-07	185	355	70	294	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd02182	GH16_Strep_laminarinase_like	7.33e-07	194	356	88	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBJ17909.1	9.45e-161	3	371	553	925
QUT89376.1	1.31e-150	75	371	508	806
ALJ59588.1	2.61e-150	75	371	508	806
QUT75447.1	5.81e-19	1	71	525	595
QQL44716.1	1.01e-18	134	358	60	263

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZRX_A	1.00e-17	2	72	515	585	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
6XOF_A	4.12e-15	145	355	71	266	ChainA, GH16 family protein [uncultured bacterium]
6XQF_A	1.90e-14	145	355	71	266	ChainA, GH16 family protein [uncultured bacterium],6XQG_A Chain A, GH16 family protein [uncultured bacterium],6XQH_A Chain A, GH16 family protein [uncultured bacterium],6XQL_A Chain A, GH16 family protein [uncultured bacterium],6XQM_A Chain A, GH16 family protein [uncultured bacterium]
6T2O_AAA	7.91e-10	145	359	79	277	ChainAAA, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2O_BBB Chain BBB, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185]
6T2N_AAA	1.07e-08	168	355	123	302	ChainAAA, Glycoside hydrolase family 16 protein [Akkermansia muciniphila],6T2N_BBB Chain BBB, Glycoside hydrolase family 16 protein [Akkermansia muciniphila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q27082	1.35e-06	172	355	84	252	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003097_03112.