CAZyme Information: MGYG000003131_01663

Basic Information

• Species: UMGS1260 sp900550105
• Lineage: Bacteria; Firmicutes_C; Negativicutes; UMGS1260; UMGS1260; UMGS1260; UMGS1260 sp900550105
• CAZyme ID: MGYG000003131_01663
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
185	MGYG000003131_30|CGC2	20444.43	8.6579

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003131	3664514	MAG	United States	North America

• Gene Location: Start: 29198; End: 29755 Strand: -

Full Sequence      

MVFIIFRKFTFILCCLLIFSGAVEAAPNQSDSDYVKSITRYIGIVNRTSDGAADYIARCI
VRSARNHQVDPLLLTSLIAKESSFRPDAVSRSGAMGLGQLMPATAASVGVADPFDIAENV
EGSARYFSQMLQQFAWTNQPVSFALAAYNAGPTTVRRYGAIPPFPETQNYVRQISRNYEI
LLQMR

Enzyme Prediction     

No EC number prediction in MGYG000003131_01663.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	66	180	2.1e-28	0.8296296296296296

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	3.55e-44	71	179	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	7.63e-37	60	180	10	148	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd13403	MLTF-like	1.39e-32	60	183	1	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	2.10e-32	60	180	8	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	1.32e-24	69	170	10	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARU40253.1	2.09e-38	21	177	63	215
QYY44477.1	1.21e-35	49	175	47	169
QGQ48609.1	3.47e-35	49	180	86	211
AGT31152.1	3.96e-35	51	180	74	203
AEE96658.1	6.07e-35	60	176	93	205

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	5.74e-11	60	177	420	551	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	5.75e-11	60	177	424	555	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	5.76e-11	60	177	430	561	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	5.77e-11	60	177	434	565	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	5.79e-11	60	177	440	571	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	1.55e-33	20	178	26	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	3.59e-28	28	178	1394	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	3.59e-28	28	178	1394	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P27380	6.90e-12	63	181	14	122	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
A4XXV1	2.21e-10	67	151	302	389	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas mendocina (strain ymp) OX=399739 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000250	0.999188	0.000147	0.000147	0.000131	0.000129

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003131_01663.