CAZyme Information: MGYG000003185_00866

Basic Information

• Species: Peptococcus niger
• Lineage: Bacteria; Firmicutes_B; Peptococcia; Peptococcales; Peptococcaceae; Peptococcus; Peptococcus niger
• CAZyme ID: MGYG000003185_00866
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	MGYG000003185_5|CGC1	39178.34	7.4759

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003185	1766648	MAG	United States	North America

• Gene Location: Start: 30437; End: 31552 Strand: +

Full Sequence      

MGVVVTGGGTGGHIYPALAIAEAIQKKHPGIDILYIGSETGLEADIVPKTGLPFAAVSAK
GLNRQLSIDTLRTLTATVKGLDMARRILKKFKANTVIGTGGFVCGPVMLAAKGQGASLFL
HEQNAYPGITNRLLAPLADGVMLNFSEARARFKGRTPLYVTGLPVRHDVGRYSRTEGAAH
FGLDLSKKTLLVTGGSRGARTINRTMAQVLPQLLQRPDLQVIFISGRNGYEETRGLLTAA
GLSPTDTPGLVFIDYLYEMPLALAAADLAIGRAGATFLAELSACGLPAVLLPYPYASENH
QAHNAQAIVDAGAAEMILDGDCTGPLMLDTVARLLDDDNRLDTMAVQMKALAKPNALADI
MQVLEEGGHLQ

Enzyme Prediction     

No EC number prediction in MGYG000003185_00866.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	189	356	8e-49	0.9936305732484076

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03785	GT28_MurG	2.46e-117	13	360	12	347	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK00726	murG	3.05e-113	13	366	14	353	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
TIGR01133	murG	4.58e-91	13	364	13	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0707	MurG	1.30e-90	13	366	13	353	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
PRK12446	PRK12446	2.54e-36	13	366	14	351	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQS58287.1	1.81e-112	1	366	1	366
AFM42638.1	2.48e-112	1	366	1	365
AEF95177.1	1.56e-111	1	365	1	365
AFQ45684.1	3.16e-111	3	363	17	376
AHF07716.1	5.69e-111	1	368	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	5.98e-52	3	366	5	353	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	1.26e-44	3	366	12	364	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
1F0K_A	1.39e-41	3	356	9	342	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8FT56	8.90e-106	1	363	1	362	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Desulfitobacterium hafniense (strain DSM 10664 / DCB-2) OX=272564 GN=murG PE=3 SV=1
Q24TE6	2.53e-105	1	363	1	362	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Desulfitobacterium hafniense (strain Y51) OX=138119 GN=murG PE=3 SV=1
A4J2B1	7.89e-105	1	366	1	366	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Desulfotomaculum reducens (strain MI-1) OX=349161 GN=murG PE=3 SV=1
B1I4C4	4.63e-104	1	366	1	366	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Desulforudis audaxviator (strain MP104C) OX=477974 GN=murG PE=3 SV=1
Q2RK79	5.64e-102	1	364	1	364	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Moorella thermoacetica (strain ATCC 39073 / JCM 9320) OX=264732 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003185_00866.