CAZyme Information: MGYG000003221_01396

Basic Information

• Species: OM05-12 sp900760755
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; OM05-12; OM05-12 sp900760755
• CAZyme ID: MGYG000003221_01396
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319	MGYG000003221_25|CGC1	36158.29	8.1237

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003221	3509168	MAG	United States	North America

• Gene Location: Start: 32713; End: 33672 Strand: -

Full Sequence      

MFAKLYRYLLIILCVFPSMLHAEIKDTLVVARDGSGKYRNIQDAIEDVRAFMDYTIVIYV
KNGIYKEKVVVPSWIKNVIIVGEDAEKTILTYDDGATIGNMGTFRTYTLKIEGNDITVKN
ITIENNAPKGTGQAVALHTEGDRLVFIGCRFLGNQDTIYTGAERTRLYFSNCYIEGTTDF
IFGPSTALFEYCTIHSKANSYVTAASTPKEVKYGYVFKNCTLTAENHVNKVYLGRPWRPY
ASTIFLNCELGKHICPAGWDNWRNPQNEKTARYAEAMNRGEGADTGKRVKWAKQLNKKEA
SNISVEEIFGEDINWFPFK

Enzyme Prediction     

No EC number prediction in MGYG000003221_01396.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	28	309	2.7e-105	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	5.67e-88	28	315	7	302	pectinesterase
pfam01095	Pectinesterase	1.23e-80	29	312	3	298	Pectinesterase.
PLN02432	PLN02432	6.80e-70	28	301	13	278	putative pectinesterase
PLN02682	PLN02682	7.89e-66	27	300	70	352	pectinesterase family protein
COG4677	PemB	3.90e-63	26	299	81	392	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AND21864.1	6.23e-155	9	317	7	314
QUT87309.1	6.46e-155	9	317	8	315
QEW38158.1	8.85e-155	9	317	7	314
QQY41711.1	1.78e-154	9	317	7	314
QQY38333.1	1.78e-154	9	317	7	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	3.06e-44	29	291	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.43e-41	22	291	3	281	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	1.90e-33	28	288	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.01e-32	28	288	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	3.23e-27	29	317	7	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	3.11e-62	30	303	9	290	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8GX86	9.38e-55	21	319	249	557	Probable pectinesterase/pectinesterase inhibitor 21 OS=Arabidopsis thaliana OX=3702 GN=PME21 PE=2 SV=2
Q8GXA1	2.12e-53	24	317	254	558	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
P41510	1.04e-52	23	303	268	558	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
O23038	7.43e-52	16	319	76	391	Probable pectinesterase 8 OS=Arabidopsis thaliana OX=3702 GN=PME8 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000211	0.999153	0.000176	0.000144	0.000143	0.000132

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003221_01396.