CAZyme Information: MGYG000003221_02583

Basic Information

• Species: OM05-12 sp900760755
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; OM05-12; OM05-12 sp900760755
• CAZyme ID: MGYG000003221_02583
• CAZy Family: CBM51
• CAZyme Description: Arylsulfatase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
460		52212.51	7.0203

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003221	3509168	MAG	United States	North America

• Gene Location: Start: 18046; End: 19428 Strand: -

Full Sequence      

MLSFGAVLLTGVSLYADEHAKINVVYILADDLGYGDLGCYGQEKIKTPNIDRLAREGMQF
MQHYAGCTVSAPSRCSLMTGLHTGHCQIRGNKEIKPEGQQPMRADTYTVGKLMKSAGYKT
GIFGKWGLGYPGSSSTPLKMGFDEFYGYNCQRQAHSYYPDHLWYNDTRVEIEENKKEGRK
VYSQDLIHEKAMKFIRDNKDRPFFTMLTYTLPHAELNLPHDSIYEMYKNAFEEVPYDGRM
GYHFSRKPYASFAAMVSRLDKYVGEVVAELKELGLDKNTIVIFASDNGPHREGGANPDYF
ESYGPLRGVKRDVYEGGIRVPMIAWCPGKIAEGVKTYHISAFWDVMPTLAELTGTTLCVA
GDGISFLPTIFSQKGQKQHSYLYWEFHELNGREALRCGKWKLIRQPVIGETILELYDLSK
DIHEDNNLARQYPSKVKELAELMDNARTPSMLFNFGKPVE

Enzyme Prediction     

No EC number prediction in MGYG000003221_02583.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16145	ARS_like	0.0	23	433	2	415	uncharacterized arylsulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16144	ARS_like	5.00e-127	23	445	2	420	uncharacterized arylsulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16146	ARS_like	2.95e-113	23	439	2	397	uncharacterized arylsulfatase. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16026	GALNS_like	4.85e-107	23	429	3	399	galactosamine-6-sulfatase; also known as N-acetylgalactosamine-6-sulfatase (GALNS). Lysosomal galactosamine-6-sulfatase removes sulfate groups from a terminal N-acetylgalactosamine-6-sulfate (or galactose-6-sulfate) in mucopolysaccharides such as keratan sulfate and chondroitin-6-sulfate. Defects in GALNS lead to accumulation of substrates, resulting in the development of the lysosomal storage disease mucopolysaccharidosis IV A.
cd16143	ARS_like	5.15e-103	23	429	2	395	uncharacterized arylsulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJF68301.1	1.56e-103	23	443	49	474
ANJ26142.1	1.57e-103	23	443	56	489
QES47792.1	6.33e-103	23	443	48	473
AZM93618.1	5.72e-102	23	443	43	468
CCA60043.1	3.63e-100	23	443	46	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7ANA_AAA	1.09e-142	18	447	26	498	ChainAAA, N-acetylgalactosamine-6-sulfatase [Bacteroides thetaiotaomicron VPI-5482],7ANA_BBB Chain BBB, N-acetylgalactosamine-6-sulfatase [Bacteroides thetaiotaomicron VPI-5482],7ANB_AAA Chain AAA, N-acetylgalactosamine-6-sulfatase [Bacteroides thetaiotaomicron VPI-5482],7ANB_BBB Chain BBB, N-acetylgalactosamine-6-sulfatase [Bacteroides thetaiotaomicron VPI-5482]
7AN1_AAA	3.87e-142	18	458	26	507	ChainAAA, Arylsulfatase [Bacteroides thetaiotaomicron VPI-5482],7OQD_AAA Chain AAA, Arylsulfatase [Bacteroides thetaiotaomicron VPI-5482]
6PSM_A	7.04e-68	20	439	23	429	Crystalstructure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_B Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_C Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_D Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_E Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_F Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSO_A Crystal structure of PsS1_19B C77S in complex with iota-neocarratetraose [Pseudoalteromonas fuliginea],6PSO_B Crystal structure of PsS1_19B C77S in complex with iota-neocarratetraose [Pseudoalteromonas fuliginea]
6PRM_A	3.82e-67	20	439	23	429	Crystalstructure of apo PsS1_19B [Pseudoalteromonas fuliginea],6PRM_B Crystal structure of apo PsS1_19B [Pseudoalteromonas fuliginea],6PRM_C Crystal structure of apo PsS1_19B [Pseudoalteromonas fuliginea],6PRM_D Crystal structure of apo PsS1_19B [Pseudoalteromonas fuliginea]
7STT_A	5.93e-53	21	445	6	431	ChainA, N-acetylgalactosamine-6-sulfatase [Pedobacter yulinensis],7STU_A Chain A, N-acetylgalactosamine-6-sulfatase [Pedobacter yulinensis],7STV_A Chain A, N-acetylgalactosamine-6-sulfatase [Pedobacter yulinensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A2H2	6.26e-44	21	448	34	510	N-acetylgalactosamine-6-O-sulfatase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_3333 PE=1 SV=1
Q32KJ6	8.79e-40	23	370	33	374	N-acetylgalactosamine-6-sulfatase OS=Rattus norvegicus OX=10116 GN=Galns PE=1 SV=1
Q571E4	1.58e-39	23	401	29	397	N-acetylgalactosamine-6-sulfatase OS=Mus musculus OX=10090 GN=Galns PE=1 SV=2
P14000	2.37e-39	14	401	40	418	Arylsulfatase OS=Hemicentrotus pulcherrimus OX=7650 PE=1 SV=1
P15289	4.73e-39	23	428	22	441	Arylsulfatase A OS=Homo sapiens OX=9606 GN=ARSA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000727	0.998403	0.000194	0.000239	0.000207	0.000212

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003221_02583.