CAZyme Information: MGYG000003249_00395

Basic Information

• Species: Victivallis sp900761715
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900761715
• CAZyme ID: MGYG000003249_00395
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1180		129888.69	5.2542

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003249	2933905	MAG	United States	North America

• Gene Location: Start: 841; End: 4383 Strand: +

Full Sequence      

MKLRTSGALGAVLLAVAVEAAPISEFTTVEPWLGHESATRDQTLAVATIPGGSGQALKLS
WGAQRFHYAELHLKKFLPLPEFTKAVFTLRLYVPANTPASRIALRLMDQSGETFQFSKSF
PVFPEAGWRTVEFTVDAAQLVTNSWGGNKNQRIDFPVRLQGFSVDFTADGGAGELYFESL
DLAYESAKSDAALQTLKLTDFAKPEHWELFQGETRRQNAVAQAPPGRTKVGAALSWDGTK
NSYLEYHLKNAQKLSDFSKAQFTLSTYLPAKAPVRSFGLRLVDAGNEVFQFTVPVQVPPD
GGQVDVRFEVDPGNLSNASSWGGNNNKRIDFPVSLYGFASDFTAGSGQGNAWLLEATMTA
PGLKVPSAAESITLDVETGNPVHVLRVGEEKELMLRFTNTGLSDYQGGVTVEFENFDGHS
FTQRADLNLAAGASVTVTPKQLPDSLGIWYVRTRFDVTEGLPVTRSRTFAYFAPTGPTPG
TAEGFLWGVSSHPQSHPAADQKLEALAAALVGIKVVREDIRWGGVQPERGRWEFGSMDRT
VEIFGQENIELEAILCYCAPWAASEQARKEGWAGRAAPEINAWKEFCAAMAQRYRGKIRF
YEVWNEPDLEGFARFGVDEYAEMMRTAYAAIKAADPDAVVLTGGYATMSDHPSKKGDFQE
QTLVKGKGSYDIHAYHEHGSFYPHFVRMVEERFLPMRERTGTTEPWWANETALSSAGDRE
REQALALYKKLLYSWSRGAIGYNWYDLRNDGYDPLDGEHNYGMITKDFYPKAVYPVYNTL
VSLFRGKEYRKQLDVGPMRWVLAFGDEKELVVAAWCEARASLAAVLRTDAVAAEAVDVMG
NITPVPVVDGRVLLKLGSDPVSLRLKGAKNVEFSGNLVELNATGVAIPGRDYQFAATLVN
PFDRAVEYQLTLTAPAGMEPASSVRKVTIPARESKTENFELAVTPGFRPAFGSELNLAFD
YELTTDRSYSGRIQLPITATVLIPNSDAAARQPDFTLTKPEQVVSLFPADPTKSHLLWQG
EKDLSGKLWLTAGNGKLGLIAEITDDKHVQPNTGSAVWRGDNLQLALVLPGQRGNWELGL
TRLADGKPEVWCWMAPTGFTEADVIAATRLTTTREGNLTRYQAEIPFEALGLTPAMLKAG
IRFNLLVNDNDGEGREGWIHVAPGIGLDKVPERYPFVIFE

Enzyme Prediction     

No EC number prediction in MGYG000003249_00395.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	528	815	1.6e-27	0.7238979118329466

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	6.45e-69	993	1179	1	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd09619	CBM9_like_4	4.20e-11	1017	1164	29	175	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
COG3693	XynA	2.38e-08	488	658	20	206	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].
cd00241	DOMON_like	4.99e-06	1008	1160	2	157	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
pfam01229	Glyco_hydro_39	2.40e-05	572	686	114	237	Glycosyl hydrolases family 39.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM47149.1	9.04e-280	57	1180	52	1307
AVM46276.1	2.29e-234	50	1180	30	1137
AHF94342.1	1.42e-190	234	1180	85	1033
AHF90198.1	4.04e-179	213	1179	40	1005
AVM44759.1	6.99e-179	350	1180	147	965

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000372	0.998852	0.000188	0.000212	0.000184	0.000173

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003249_00395.