CAZyme Information: MGYG000003249_01158

Basic Information

• Species: Victivallis sp900761715
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900761715
• CAZyme ID: MGYG000003249_01158
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
563		62374.22	6.3174

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003249	2933905	MAG	United States	North America

• Gene Location: Start: 1462; End: 3153 Strand: +

Full Sequence      

MMKTNTTGKLSYPGMVMDRKAHAYVPPRRVVRATGTVNAESLLEQAQVQTIVNPHRELTV
IPPGGELILDFGRELHGQLLLTTGGMPNDRQLMVDVTLGESVSETLGTPTMDHAVHQLSM
AAPTLGQVYFGNSAFRFVRLTLAPDAPHALSLQSAVAVAVYQDWEYRGYFESDDSLLNRI
WQTGAYTVHLNCQDYIYDGVKRDRLVWMGDLYPEIRTLLAVFDETDLIEKSLDFMRDTTV
PPEWMNGISSYSCWWLICQRDLYFYRGNYAYLERQRSALSALLRQLLACVEADGREQLTG
WRFLDWSTADDEQVKHAGLQGLLAWTLQAGVFLATELALPALAERCRTAVNRLHRQSPDC
CGNKVAAAMLALGGVSDPTALNRRIFSVDPCRGISTFYGYFVLQARALAGDTAGAVELIR
NYWGGMLKFGATTFWEDFDLDWTKNAYGIDSLPVAGKQDIHGDFGKHCYVGLRHSLCHGW
AGGPTAFLSESVMGVRPMAPGCRKVQVAPELPAGVNRLEGGFPTPYGLIEVSARRVGNAI
RSKVKLPDEIVPVFSSSGNETLM

Enzyme Prediction     

No EC number prediction in MGYG000003249_01158.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	63	548	9e-87	0.9742063492063492

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.72e-16	168	441	4	315	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	9.19e-08	494	547	1	54	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45729.1	1.04e-256	2	550	1	545
QEH42293.1	1.01e-169	24	555	40	577
QUR50485.1	8.87e-164	18	550	23	578
QUT19201.1	1.78e-163	18	550	23	578
BBK91321.1	2.51e-163	18	550	23	578

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	2.62e-35	63	531	190	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	3.21e-27	135	550	505	935	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	8.64e-16	17	490	50	540	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003249_01158.