CAZyme Information: MGYG000003249_02187

Basic Information

• Species: Victivallis sp900761715
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900761715
• CAZyme ID: MGYG000003249_02187
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
769		88970.71	6.1304

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003249	2933905	MAG	United States	North America

• Gene Location: Start: 606; End: 2915 Strand: -

Full Sequence      

MVDLQILYFKLFIITFLKMSFFIHEVPIPISYFVSANGKSKNREKILIFLNEIWKIAIEK
QQEDATLKKPLLKTSAIKPSQKRKHMKEIPEHFQGQWITTAEFCNLRPQNMFHRQLDTGS
LPVSEPERQNRHILFRKKFTMKGAVSTVIRISGDDYYKLYINGVRVGQGPAAGYPFHYFY
NEIDISRFVHAGVNTLAVHSYYQGLINRVWVSGDRRHGVIFDLLADGELIACSDESVRCR
EHSGFVSAGITGYQTQFLECYDAAAPEVGFERPEFDDSGWECACIHRHADYRLFRQPSEQ
LTIEEIRPEKIEKCGASWRIDFGGIFVGSLRFRASGDRGLEVVMYFAQELEPDGSLRWKL
RANCAYKESFLLSGAEWDVLNQFDYKSFRYAELQCPPGCRIDPESIVLEARHYPFVLRAV
CNRNDEKSLAVWKLCVDSLRYGVQEVIQDCMEREKGYYLGDGCYSLLTFCLLTRDYTLME
KFFDDFLRTAFVNRGLMTCAACSFMQEIAEYPLIMFGLLLEYCHLSGNRDFVRERYAAFA
DILDFYRENYAEADGLLNRLDKWCVVEWPNNMRDNYDVDLTEGKVCDTKHNAINAYYIGA
VKCLNKIARWIGLEPYADAAALQAAFVEAFYDRERKLFRDSVESGHISMPGNIYAAFYEL
FPDRAGVKNVIAMIREKRLSQSLLFVTFPLLAFLKKENEDELLRELLTDDQAWLNILAEG
GTRTFEGWGRETKWNTSLFHLTLTFGAAFLTDWNISDILSFSEVPHEKH

Enzyme Prediction     

No EC number prediction in MGYG000003249_02187.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	317	741	4.8e-57	0.8313492063492064
CBM67	126	284	1.6e-33	0.8863636363636364

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08531	Bac_rhamnosid_N	6.01e-10	142	280	1	147	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.04e-09	320	406	10	96	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17389	Bac_rhamnosid6H	1.66e-04	526	728	114	312	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
PRK10340	ebgA	0.007	134	201	112	178	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM43798.1	0.0	19	769	1	751
QBE96895.1	1.01e-137	93	740	4	647
QQQ94267.1	1.43e-137	93	740	4	648
ANU76688.1	1.43e-137	93	740	4	648
ASU29495.1	1.43e-137	93	740	4	648

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	3.28e-14	122	398	297	580	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	6.37e-13	134	398	178	446	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	1.79e-13	122	398	297	580	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.984171	0.015482	0.000207	0.000039	0.000023	0.000070

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003249_02187.